Rabbit Polyclonal Anti-PFKP Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human PFKP |
Rabbit Polyclonal Anti-PFKP Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human PFKP |
Rabbit Polyclonal antibody to PGD (phosphogluconate dehydrogenase)
Applications | IF, IHC, WB |
Reactivities | Human (Predicted: Mouse, Chicken, Xenopus, Zebrafish, Bovine) |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 201 of PGD (Uniprot ID#P52209) |
Rabbit polyclonal Aldolase (ALDOA) Antibody (N-term)
Applications | IF, IHC, WB |
Reactivities | Human (Predicted: Mouse, Rat, Rabbit) |
Conjugation | Unconjugated |
Immunogen | This Aldolase (ALDOA) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 66-95 amino acids from the N-terminal region of human Aldolase (ALDOA). |
USD 580.00
2 Weeks
Glucose 6 phosphate isomerase (GPI) (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | FC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide between 452~481 amino acids from the C-terminal region of human GPI |
RPEL1 (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | FC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide between 187-215 amino acids from the C-terminal region of human hCG_2024410 |
Rabbit Polyclonal Anti-PGLS Antibody - middle region
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PGLS antibody: synthetic peptide directed towards the middle region of human PGLS. Synthetic peptide located within the following region: AAVLKRILEDQEENPLPAALVQPHTGKLCWFLDEAAARLLTVPFEKHSTL |
Rabbit polyclonal antibody to PRPS1L1 (phosphoribosyl pyrophosphate synthetase 1-like 1)
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 318 of PRPS1L1 (Uniprot ID#P21108) |
Rabbit polyclonal anti-PGLS antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human PGLS. |
Rabbit Polyclonal Anti-TKTL2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TKTL2 antibody: synthetic peptide directed towards the C terminal of human TKTL2. Synthetic peptide located within the following region: SSAKATGGRVITVEDHYREGGIGEAVCAAVSREPDILVHQLAVSGVPQRG |
Aldolase C (ALDOC) (C-term) rabbit polyclonal antibody, Ig Fraction
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | ALDOC antibody was raised against kLH conjugated synthetic peptide selected from the C-terminal region of Human ALDOC. Epitope: C-Terminus |
Rabbit polyclonal PFKL Antibody (C-term L684)
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | This PFKL antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 669-699 amino acids from the C-terminal region of human PFKL. |
Rabbit Polyclonal Anti-PFKL Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human PFKL |
PFKL rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide, corresponding to amino acids 700-750 of Human PFKL. |
Aldolase C (ALDOC) (N-term) rabbit polyclonal antibody, Purified
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide between 79-108 amino acids from the N-terminal region of human ALDOC. |
Rabbit anti-ALDOA Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human ALDOA |