Primary Antibodies

Jump to Filters

Download

1 - 15 of 1439 results

Page 1 of 96

(reset)

Oct4 (POU5F1) Rabbit Polyclonal Antibody

AP06256PU-N

USD 445.00

3 Weeks

Oct4 (POU5F1) rabbit polyclonal antibody, Aff - Purified

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Synthetic peptide, corresponding to amino acids 200-250 of Human Oct-3/4.

1 / 2

2 / 2

Previous Next

BIRC5 Rabbit Polyclonal Antibody

TA301775

USD 550.00

5 Days

Rabbit Polyclonal Antibody against Survivin - Astrocyte Marker

Applications	ChIP, ELISA, FC, ICC/IF, IHC, IP, Simple Western, WB
Reactivities	Human, Mouse, Rat, Feline, Dog
Conjugation	Unconjugated
Immunogen	Full-length recombinant human survivin.

1 / 13

2 / 13

3 / 13

4 / 13

5 / 13

6 / 13

7 / 13

8 / 13

9 / 13

10 / 13

11 / 13

12 / 13

13 / 13

Previous Next

Hsp60 (HSPD1) Rabbit Polyclonal Antibody

TA336826

USD 550.00

5 Days

Rabbit Polyclonal HSP60 Antibody

Applications	FC, ICC/IF, IHC, Immunoblotting, Simple Western, WB
Reactivities	Human, Mouse, Rat, Hamster, Primate
Conjugation	Unconjugated
Immunogen	A synthetic peptide made to an internal region of the human Hsp60 protein (within residues 70-150). [Swiss-Prot P10809]

1 / 12

2 / 12

3 / 12

4 / 12

5 / 12

6 / 12

7 / 12

8 / 12

9 / 12

10 / 12

11 / 12

12 / 12

Previous Next

HMG1 (HMGB1) Rabbit Polyclonal Antibody

TA301448

USD 630.00

2 Weeks

Rabbit Polyclonal Antibody against HMGB1 - Oligodendrocyte Marker

Applications	ELISA, FC, ICC/IF, IHC, Simple Western, WB
Reactivities	Human, Mouse, Dog, Bovine, Hamster, Rat
Conjugation	Unconjugated
Immunogen	A synthetic peptide made to an internal portion of the human HMGB1 protein sequence (between residues 100-200). [UniProt #P09429]

1 / 12

2 / 12

3 / 12

4 / 12

5 / 12

6 / 12

7 / 12

8 / 12

9 / 12

10 / 12

11 / 12

12 / 12

Previous Next

PCNA Rabbit Polyclonal Antibody

TA590137

USD 482.00

In Stock

Rabbit Polyclonal PCNA Antibody

Applications	ELISA, IHC, WB
Reactivities	Human, Dog, Rat, Monkey, Mouse
Conjugation	Unconjugated
Immunogen	DNA immunization. This antibody is specific for the Middle Region of the target protein.

1 / 13

2 / 13

3 / 13

4 / 13

5 / 13

6 / 13

7 / 13

8 / 13

9 / 13

10 / 13

11 / 13

12 / 13

13 / 13

Previous Next

Ku80 (XRCC5) Rabbit Polyclonal Antibody

TA590469

USD 482.00

In Stock

Rabbit Polyclonal Ku80 Antibody

Applications	ELISA, IHC, WB
Reactivities	Human, Dog, Monkey, Mouse
Conjugation	Unconjugated
Immunogen	DNA immunization. This antibody is specific for the C Terminus Region of the target protein.

1 / 12

2 / 12

3 / 12

4 / 12

5 / 12

6 / 12

7 / 12

8 / 12

9 / 12

10 / 12

11 / 12

12 / 12

Previous Next

Nucleophosmin (NPM1) Rabbit Polyclonal Antibody

TA301725

USD 550.00

2 Weeks

Rabbit Polyclonal Antibody against Nucleophosmin, mutant - AML Marker

Applications	FC, ICC/IF, IHC, IP, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	A synthetic peptide made to a C-terminal region of human mutant nucleophosmin (exact sequence is within residues 250-298).

1 / 3

2 / 3

3 / 3

Previous Next

Thymidine Kinase 1 (TK1) Rabbit Polyclonal Antibody

TA314626

USD 380.00

4 Weeks

Rabbit polyclonal TK (Ab-13) antibody

Applications	IF, IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	The antiserum was produced against synthesized non-phosphopeptide derived from human TK around the phosphorylation site of serine 13 (P-G-SP-P-S).

1 / 3

2 / 3

3 / 3

Previous Next

Oct4 (POU5F1) Rabbit Polyclonal Antibody

TA301457

USD 550.00

5 Days

Rabbit Polyclonal Antibody against OCT4 - Embryonic Stem Cell Marker

Applications	FC, ICC/IF, IHC, WB
Reactivities	Human, Monkey
Conjugation	Unconjugated
Immunogen	A synthetic peptide made to an internal portion of the human OCT4 protein sequence (between residues 100-200).

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

HDAC2 Rabbit Polyclonal Antibody

TA590734

USD 482.00

In Stock

Rabbit Polyclonal HDAC2 Antibody

Applications	ELISA, IHC, WB
Reactivities	Human, Dog, Rat, Monkey, Mouse
Conjugation	Unconjugated
Immunogen	DNA immunization. This antibody is specific for the C Terminus Region of the target protein.

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

OTX2 Rabbit Polyclonal Antibody

TA330538

USD 539.00

5 Days

Rabbit Polyclonal Anti-OTX2 Antibody

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for anti-OTX2 antibody: synthetic peptide directed towards the N terminal of human OTX2. Synthetic peptide located within the following region: PESRVQVWFKNRRAKCRQQQQQQQNGGQNKVRPAKKKTSPAREVSSESGT

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

Caspase 9 (CASP9) Rabbit Polyclonal Antibody

TA312629

USD 380.00

In Stock

Rabbit polyclonal Caspase 9 (Cleaved-Asp315) antibody

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The antiserum was produced against synthesized peptide derived from human Caspase 9.

1 / 2

2 / 2

Previous Next

BCL2 Rabbit Monoclonal Antibody [Clone ID: OTIR1C12]

TA592344

USD 379.00

2 Weeks

BCL2 Rabbit monoclonal antibody,clone OTIR1C12

Applications	IHC
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 3

2 / 3

3 / 3

Previous Next

BCL2 Rabbit Monoclonal Antibody [Clone ID: OTIR1H2]

TA592345

USD 379.00

2 Weeks

BCL2 Rabbit monoclonal antibody,clone OTIR1H2

Applications	IHC
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 3

2 / 3

3 / 3

Previous Next

BCL2 Rabbit Monoclonal Antibody [Clone ID: OTIR3F2]

TA592348

USD 379.00

2 Weeks

BCL2 Rabbit monoclonal antibody,clone OTIR3F2

Applications	IHC
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 3

2 / 3

3 / 3

Previous Next

1 - 15 of 1439 results

Page 1 of 96