Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-RXRA Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-RXRA Antibody: synthetic peptide directed towards the N terminal of human RXRA. Synthetic peptide located within the following region: DTKHFLPLDFSTQVNSSLTSPTGRGSMAAPSLHPSLGPGIGSPGQLHSPI

Rabbit Polyclonal NGFI-B alpha/Nur77/NR4A1 Antibody

Applications ChIP, ICC/IF, IHC, IP, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This antibody was developed against a synthetic peptide corresponding to aa 251-266 of human Nak1 (NP_775180).

Rabbit polyclonal GR (Ab-211) antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human GR around the phosphorylation site of serine 211 (N-E-S-P-W).

Rabbit polyclonal NURR1 (NR4A2) Antibody (N-term)

Applications IF, IHC, WB
Reactivities Human, Mouse (Predicted: Rat, Bovine)
Conjugation Unconjugated
Immunogen This NURR1 (NR4A2) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 13-42 amino acids from the N-terminal region of human NURR1 (NR4A2).

Rabbit Polyclonal ERR alpha/NR3B1 Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide made to an N-terminal portion of human Estrogen Related Receptor alpha (within residues 1-50). [Swiss-Prot# P11474]

Rabbit polyclonal Retinoid X Receptor gamma antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human Retinoid X Receptor ? antibody.

Rabbit polyclonal Nuclear Receptor NR4A1 (Ab-351) antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human Nuclear Receptor NR4A1 around the phosphorylation site of serine 351 (L-P-SP-K-P).

Rabbit polyclonal ESRRA Antibody (Center)

Applications FC, IF, IHC, WB
Reactivities Human (Predicted: Mouse, Rat)
Conjugation Unconjugated
Immunogen This ESRRA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 131-159 amino acids from the Central region of human ESRRA.

Rabbit Polyclonal Anti-ESRRG Antibody (C-Terminus)

Applications IHC
Reactivities Human (Predicted: Bat, Xenopus, Zebrafish)
Conjugation Unconjugated
Immunogen ESRRG / ERR Gamma antibody was raised against synthetic 15 amino acid peptide from C-terminus of human ESRRG / ERR3. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Dog, Bovine, Horse, Rabbit, Pig, Opossum, Turkey, Chicken, Platypus, Lizard (100%); Bat, Xenopus, Zebrafish (93%); Stickleback, Medaka, Pufferfish (87%).

Rabbit Polyclonal Anti-TRIP4 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human TRIP4

Rabbit Polyclonal Anti-ESR2 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human ESR2

Rabbit Polyclonal Anti-NR3C1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human NR3C1

Rabbit Polyclonal Anti-PGRMC2 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human PGRMC2