Rabbit Polyclonal Anti-EME1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EME1 antibody: synthetic peptide directed towards the N terminal of human EME1. Synthetic peptide located within the following region: MALKKSSPSLDSGDSDSEELPTFAFLKKEPSSTKRRQPEREEKIVVVDIS |
Rabbit Polyclonal Anti-EME1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EME1 antibody: synthetic peptide directed towards the middle region of human EME1. Synthetic peptide located within the following region: AYPSPQLLVQAYQQCFSDKERQNLLADIQVRRGEGVTSTSRRIGPELSRR |
Germany
Japan
United Kingdom
China