Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
ABCC4 Rabbit Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human ABCC4 |
Rabbit Polyclonal ABCA1 Antibody
| Applications | Block/Neutralize, ChIP, ELISA, FC, ICC/IF, IHC, Immunoblotting, IP, Simple Western, WB |
| Reactivities | Human, Mouse, Rat, Hamster |
| Conjugation | Unconjugated |
| Immunogen | Partial peptide sequence (peptide used resides somewhere between a.a 1100-1300) of the human ABCA1 gene. Actual immunogen sequence is proprietary information. |
Anti-ABCG2 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 609-621 amino acids of Human ATP-binding cassette sub-family G member 2 |
TA322704 is a possible alternative to TA324234.
Rabbit Polyclonal anti-CFTR Antibody
| Applications | ICC/IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CFTR |
TA890106 is the same product as TA374684.
Anti-ABCB6 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 590-824 amino acids of human ATP-binding cassette, sub-family B (MDR/TAP), member 6 |
Anti-ABCB9 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide peptide corresponding to a region derived from 710-723 amino acids of human ATP-binding cassette, sub-family B (MDR/TAP), member 9 |
Anti-ABCB6 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 590-824 amino acids of human ATP-binding cassette, sub-family B (MDR/TAP), member 6 |
Rabbit Polyclonal Anti-ABCB4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ABCB4 antibody: synthetic peptide directed towards the N terminal of human ABCB4. Synthetic peptide located within the following region: AGAVAEEALGAIRTVIAFGGQNKELERYQKHLENAKEIGIKKAISANISM |
Rabbit polyclonal antibody to ABCD2 (ATP-binding cassette, sub-family D (ALD), member 2)
| Applications | WB |
| Reactivities | Human (Predicted: Mouse, Chicken, Rat) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 338 and 588 of ABCD2 (Uniprot ID#Q9UBJ2) |
Active filters
Applications
- WB
Antibody Hosts
- Rabbit
Pathways
- ABC transporters
Filter by
Category
Target Symbol
- ABCD4 (6)
- ABCB6 (5)
- ABCD2 (5)
- MRP3 (5)
- ABCB10 (4)
- ABCB8 (4)
- MRP1 (4)
- MRP2 (4)
- ABCA1 (3)
- ABCB5 (3)
- ABCB9 (3)
- ABCG1 (3)
- ABCG2 (3)
- CFTR (3)
- ABCA6 (2)
- ABCA7 (2)
- ABCB4 (2)
- ABCB7 (2)
- ABCC10 (2)
- ABCC9 (2)
- ABCD1 (2)
- ABCG4 (2)
- MRP4 (2)
- P GLYCOPROTEIN (2)
- PMP70 (2)
- TAP1 (2)
- TAP2 (2)
- ABCA12 (1)
- ABCA2 (1)
- ABCA5 (1)
- ABCA8 (1)
- ABCB1 (1)
- ABCC11 (1)
- ABCC12 (1)
- ABCG5 (1)
- ABCG8 (1)
- SUR1 (1)