Rabbit polyclonal XRCC5 Antibody (Center K439)
| Applications | FC, IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This XRCC5 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 424-450 amino acids from the Central region of human XRCC5. |
Rabbit polyclonal FEN1 Antibody (Center)
| Applications | IF, WB |
| Reactivities | Human (Predicted: Bovine) |
| Conjugation | Unconjugated |
| Immunogen | This FEN1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 243-272 amino acids from the Central region of human FEN1. |
DNA Ligase IV (LIG4) rabbit polyclonal antibody, Aff - Purified
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide, corresponding to amino acids 600-650 of Human DNA Ligase IV. |
Rabbit Polyclonal Anti-LIG4 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LIG4 antibody: synthetic peptide directed towards the N terminal of human LIG4. Synthetic peptide located within the following region: DGERMQMHKDGDVYKYFSRNGYNYTDQFGASPTEGSLTPFIHNAFKADIQ |
Rabbit polyclonal anti-NHEJ1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human NHEJ1 |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Germany
Japan
United Kingdom
China
