Anti-ADRB2 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 21-33 amino acids of Human adrenoceptor beta 2, surface |
Anti-ADRB2 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 21-33 amino acids of Human adrenoceptor beta 2, surface |
Anti-F2R Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 56-70 amino acids of human coagulation factor II (thrombin) receptor |
Rabbit Polyclonal Anti-Human Protease-activated Receptor-1 (extracellular)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide (C)KNESGLTEYRLVSINK, corresponding to amino acid residues 61-76 of human PAR-1. Extracellular, N terminal. |
Rabbit Polyclonal Anti-ADRB1 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ADRB1 antibody: synthetic peptide directed towards the middle region of human ADRB1. Synthetic peptide located within the following region: CTVWAISALVSFLPILMHWWRAESDEARRCYNDPKCCDFVTNRAYAIASS |
Rabbit Polyclonal CXCR4 Antibody
Applications | FC, ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to a C-terminal region of the human CXCR4 protein (within residues 300-352). [Swiss-Prot P61073] |
Rabbit Polyclonal CCR5 Antibody
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | CCR5 antibody was raised against a 15 amino acid peptide near the amino terminus of human CCR5. The immunogen is located within the first 50 amino acids of CCR5. |
Rabbit Polyclonal CXCR4 Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat, Sheep |
Conjugation | Unconjugated |
Immunogen | Rabbit anti-CXCR4 polyclonal antibody was raised against a peptide corresponding to amino acids 328-338 of human CXCR4. |
Rabbit Polyclonal CXCR4-Lo Antibody
Applications | ELISA, ICC, IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | CXCR4-Lo antibody was raised against a peptide corresponding to nine amino acids near the amino terminus of human CXCR4 isoform a. |
Rabbit Polyclonal Anti-CXCR4 (extracellular)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide (C)EGISIYTSDNYTEE,corresponding to amino acid residues 2-15 of human CXCR4. Extracellular, N-terminus. |
CXCR4 rabbit polyclonal antibody, Aff - Purified
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide, corresponding to amino acids 310-360 of Human CXCR-4. |
Rabbit polyclonal anti-ADRB2 antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ADRB2. |
Rabbit Polyclonal Anti-ADRB2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ADRB2 antibody: synthetic peptide directed towards the middle region of human ADRB2. Synthetic peptide located within the following region: TGEQSGYHVEQEKENKLLCEDLPGTEDFVGHQGTVPSDNIDSQGRNCSTN |
Rabbit Polyclonal CXCR4 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
CXCR2 rabbit polyclonal antibody, Aff - Purified
Applications | IHC, IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide mapping at the middle region of human CXCR2 |
CCR5 (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a sequence at the N-terminal of Human CCR5 |