Rabbit Polyclonal antibody to GAPDH (glyceraldehyde-3-phosphate dehydrogenase)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse (Predicted: Feline, Chicken, Dog, Drosophila, Monkey, Pig, Rabbit, Xenopus, Zebrafish, Bovine) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 335 of GAPDH (Uniprot ID#P04406) |
Rabbit Polyclonal Calnexin Antibody
| Applications | FC, ICC/IF, IHC, IP, Simple Western, WB |
| Reactivities | Human, Mouse, Rat, Bovine, Chicken, Avian, Drosophila |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an internal region of the canine Calnexin protein (within residues 25-100). [Swiss-Prot P24643] |
Rabbit Polyclonal antibody to alpha Tubulin 1A (tubulin, alpha 1a)
| Applications | IF, IHC, WB |
| Reactivities | Human, Drosophila, Rat, Mouse (Predicted: Chimpanzee, Bovine, Rhesus Monkey) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein fragment contain a sequence corresponding to a region within amino acids 37 and 276 of alpha Tubulin 1A |
GAPDH (9-323) rabbit polyclonal antibody, Aff - Purified
| Applications | IF, IHC, WB |
| Reactivities | Bovine, Canine, Drosophila, Feline, Human, Mouse, Rabbit, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein fragment corresponding to a region within amino acids 9 and 323 of GAPDH |
Rabbit polyclonal ATP6V1B1 Antibody (Center)
| Applications | IF, IHC, WB |
| Reactivities | Human (Predicted: Mouse, Rat, Bovine, Chicken, Drosophila, C. elegans) |
| Conjugation | Unconjugated |
| Immunogen | This ATP6V1B1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 284-310 amino acids from the Central region of human ATP6V1B1. |
Rabbit Polyclonal GAPDH/G3PDH Antibody
| Applications | ICC/IF, IHC, Immunoblotting, Simple Western, WB |
| Reactivities | Human, Mouse, Rat, Drosophila, Feline, Porcine, Protozoa |
| Conjugation | Unconjugated |
| Immunogen | Amino acids 73-87 PITIFQERDPSKIKW of glyceraldehyde 3-phosphate dehydrogenase protein were used as the immunogen. |
EIF3F (114-125) rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, IF, IHC, IP, WB |
| Reactivities | Bovine, Chicken, Human, Mouse, Rat, Drosophila, Fish, Monkey |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide from aa 114-125 of human EIF3F |
Rabbit Polyclonal Antibody against CDC2 (T14)
| Applications | IHC, WB |
| Reactivities | Human (Predicted: Mouse, Rat, Bovine, Chicken, Drosophila, Xenopus) |
| Conjugation | Unconjugated |
| Immunogen | This CDK1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from human CDK1. |
Rabbit Polyclonal Anti-TUBE1 Antibody - middle region
| Applications | IHC, WB |
| Reactivities | Drosophila, Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TUBE1 antibody: synthetic peptide directed towards the middle region of human TUBE1. Synthetic peptide located within the following region: HLHHYLQVEGMEESCFTEAVSSLSALIQEYDQLDATKNMPVQDLPRLSIA |
GRP94 (HSP90B1) rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, IHC, WB |
| Reactivities | Chicken, Drosophila, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide. |
mib1 rabbit polyclonal antibody, Serum
| Applications | ELISA, IHC, WB |
| Reactivities | Drosophila |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide derived from Nter domain of Drosophila melanogaster (Fruit fly) MIB |
fkh rabbit polyclonal antibody, Serum
| Applications | ELISA, IHC, WB |
| Reactivities | Drosophila |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide derived from internal domain of the Drosophila Protein fork head. |
Gl rabbit polyclonal antibody, Serum
| Applications | ELISA, IHC, WB |
| Reactivities | Drosophila |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide derived from N-terminal domain of the Drosophila melanogaster DCTN1 protein. |
Germany
Japan
United Kingdom
China
