RSPO3 (NM_032784) Human Recombinant Protein
Purified recombinant protein of Human R-spondin 3 homolog (Xenopus laevis) (RSPO3)
Product images

Specifications
Product Data | |
Description | Purified recombinant protein of Human R-spondin 3 homolog (Xenopus laevis) (RSPO3) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | QNASRGRRQRRMHPNVSQGCQGGCATCSDYNGCLSCKPRLFFALERIGMKQIGVCLSSCPSGYYGTRYPDINKCTKCKADCDTCFNKNFCTKCKSGFYLHLGKCLDNCPEGLEANNHTMECVSIVHCEVSEWNPWSPCTKKGKTCGFKRGTETRVREIIQHPSAKGNLCPPTNETRKCTVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK HHHHHH |
Tag | C-Fc/His |
Predicted MW | 56.3 kDa |
Concentration | lot specific |
Purity | >95% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | Lyophilized from a 0.2 µM filtered solution of PBS,pH 7.4 |
Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Storage | Store at -80°C. |
Stability | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_116173 |
Locus ID | 84870 |
Refseq Size | 4583 |
Cytogenetics | 6q22.33 |
Refseq ORF | 816 |
Synonyms | CRISTIN1; PWTSR; THSD2 |
Summary | This gene belongs to the R-spondin family. The encoded protein plays a role in the regulation of Wnt (wingless-type MMTV integration site family)/beta-catenin and Wnt/planar cell polarity (PCP) signaling pathways, which are involved in development, cell growth and disease pathogenesis. Genome-wide association studies suggest a correlation of this gene with bone mineral density and risk of fracture. This gene may be involved in tumor development. [provided by RefSeq, Jul 2013] |
Protein Families | Druggable Genome, Secreted Protein |
Documents
FAQs |
SDS |
Resources
Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403201 | RSPO3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 110.00 |
|
LY403201 | Transient overexpression lysate of R-spondin 3 homolog (Xenopus laevis) (RSPO3) |
USD 360.00 |
|
TP723387 | Purified recombinant protein of Human R-spondin 3 homolog (Xenopus laevis) (RSPO3). |
USD 240.00 |
|
TP762097 | Purified recombinant protein of Human R-spondin 3 homolog (Xenopus laevis) (RSPO3),Gln22-End, with N-terminal His tag, expressed in E. coli, 50ug |
USD 215.00 |
USD 379.00