Alox12 (NM_007440) Mouse Recombinant Protein

CAT#: TP527302

Purified recombinant protein of Mouse arachidonate 12-lipoxygenase (Alox12), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR227302 representing NM_007440
  Red=Cloning site Green=Tags(s)
  
  MGRYRVRVVTGAWLFSGSLNLVRLWLVGEHREAKLELQLRPARGKEEEFDFDVPEDLGPLQFVKLHKQHT
  VVDDAWFCNLITVQGPGTSAEAVFPCYRWVQGEGILSLPEGTARLAGDNALDVFQKYREKELKERQQTYC
  WATWKEGLPQTIAADCKDDLPPNMRFHEEKRLDFEWTLKAGVLEMGLKRVYTLLRSWNHLEDFDQIFWGQ
  KSALAEKVHQCWQEDELFGYQFLNGANPMLLRRSTSLPSRLVLPSGMEELQAQLEKELKNGSLFEADFIL
  LDGIPANVIRGEPQYLAAPLVMLRMDPGGKLLPMAIQIQPPNPSSPAPTLFLPSDPPLAWLLAKIWVRNS
  DFQLQELQFHLLNTHLVAEVIAVATMRCLPGLHPIFKLLVPHIRYTMEINTRSRTQLISDGGIFDQVVST
  GGGGHVQLLTRAVAQLTYHSLCPPDDLANRGLLRIPSALYARDALQLWEVTARYVKGMVHLFYQSDDIVR
  GDPELQAWCREITEVGLCHAQDRGFPVSFQSRAQLCHFLTMCVFTCTAQHAAINQGQLDWYGWVPNAPCT
  MRMPPPTSKDDVTMETVMGSLPDVQKACLQMTITWHLGRLQPDMVPLGHHTEKYFSDPRTKAVLSQFQAD
  LDNLEKEITARNEQLDLPYEYLKPSRIENSITI
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 75.8 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_031466
• Locus ID: 11684
• UniProt ID: P39655, A2CF85
• Cytogenetics: 11 42.99 cM
• Refseq Size: 2991
• Refseq ORF: 1989
• Synonyms: 9930022G08Rik; Alox12p; P-12LO
• Summary: Non-heme iron-containing dioxygenase that catalyzes the stereo-specific peroxidation of free and esterified polyunsaturated fatty acids generating a spectrum of bioactive lipid mediators. Mainly converts arachidonic acid to (12S)-hydroperoxyeicosatetraenoic acid/(12S)-HPETE but can also metabolize linoleic acid. Has a dual activity since it also converts leukotriene A4/LTA4 into both the bioactive lipoxin A4/LXA4 and lipoxin B4/LXB4. Through the production of specific bioactive lipids like (12S)-HPETE it regulates different biological processes including platelet activation. It also probably positively regulates angiogenesis through regulation of the expression of the vascular endothelial growth factor. Plays a role in apoptotic process, promoting the survival of vascular smooth muscle cells for instance. May also play a role in the control of cell migration and proliferation.[UniProtKB/Swiss-Prot Function]