Cd19 (NM_009844) Mouse Recombinant Protein

CAT#: TP526845

Purified recombinant protein of Mouse CD19 antigen (Cd19), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR226845 representing NM_009844
  Red=Cloning site Green=Tags(s)
  
  MPSPLPVSFLLFLTLVGGRPQKSLLVEVEEGGNVVLPCLPDSSPVSSEKLAWYRGNQSTPFLELSPGSPG
  LGLHVGSLGILLVIVNVSDHMGGFYLCQKRPPFKDIWQPAWTVNVEDSGEMFRWNASDVRDLDCDLRNRS
  SGSHRSTSGSQLYVWAKDHPKVWGTKPVCAPRGSSLNQSLINQDLTVAPGSTLWLSCGVPPVPVAKGSIS
  WTHVHPRRPNVSLLSLSLGGEHPVREMWVWGSLLLLPQATALDEGTYYCLRGNLTIERHVKVIARSAVWL
  WLLRTGGWIVPVVTLVYVIFCMVSLVAFLYCQRAFILRRKRKRMTDPARRFFKVTPPSGNGTQNQYGNVL
  SLPTSTSGQAHAQRWAAGLGSVPGSYGNPRIQVQDTGAQSHETGLEEEGEAYEEPDSEEGSEFYENDSNL
  GQDQVSQDGSGYENPEDEPMGPEEEDSFSNAESYENADEELAQPVGRMMDFLSPHGSAWDPSREASSLGS
  QSYEDMRGILYAAPQLHSIQSGPSHEEDADSYENMDKSDDLEPAWEGEGHMGTWGTT
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 60.6 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_033974
• Locus ID: 12478
• UniProt ID: P25918, Q3TQG5
• Cytogenetics: 7 69.01 cM
• Refseq Size: 2440
• Refseq ORF: 1641
• Synonyms: AW495831
• Summary: Functions as coreceptor for the B-cell antigen receptor complex (BCR) on B-lymphocytes. Decreases the threshold for activation of downstream signaling pathways and for triggering B-cell responses to antigens (By similarity). Activates signaling pathways that lead to the activation of phosphatidylinositol 3-kinase and the mobilization of intracellular Ca(2+) stores (PubMed:9382888, PubMed:12387743, PubMed:20101619). Is not required for early steps during B cell differentiation in the blood marrow (PubMed:7542548, PubMed:7543183, PubMed:9317126). Required for normal differentiation of B-1 cells (PubMed:7542548, PubMed:7543183, PubMed:12387743). Required for normal B cell differentiation and proliferation in response to antigen challenges (PubMed:7542548, PubMed:9317126, PubMed:12387743). Required for normal levels of serum immunoglobulins, and for production of high-affinity antibodies in response to antigen challenge (PubMed:7542548, PubMed:7543183, PubMed:12387743).[UniProtKB/Swiss-Prot Function]