Cd19 (NM_009844) Mouse Recombinant Protein
CAT#: TP526845
Purified recombinant protein of Mouse CD19 antigen (Cd19), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Product Images
Frequently bought together (2)
Other products for "Cd19"
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR226845 representing NM_009844
Red=Cloning site Green=Tags(s) MPSPLPVSFLLFLTLVGGRPQKSLLVEVEEGGNVVLPCLPDSSPVSSEKLAWYRGNQSTPFLELSPGSPG LGLHVGSLGILLVIVNVSDHMGGFYLCQKRPPFKDIWQPAWTVNVEDSGEMFRWNASDVRDLDCDLRNRS SGSHRSTSGSQLYVWAKDHPKVWGTKPVCAPRGSSLNQSLINQDLTVAPGSTLWLSCGVPPVPVAKGSIS WTHVHPRRPNVSLLSLSLGGEHPVREMWVWGSLLLLPQATALDEGTYYCLRGNLTIERHVKVIARSAVWL WLLRTGGWIVPVVTLVYVIFCMVSLVAFLYCQRAFILRRKRKRMTDPARRFFKVTPPSGNGTQNQYGNVL SLPTSTSGQAHAQRWAAGLGSVPGSYGNPRIQVQDTGAQSHETGLEEEGEAYEEPDSEEGSEFYENDSNL GQDQVSQDGSGYENPEDEPMGPEEEDSFSNAESYENADEELAQPVGRMMDFLSPHGSAWDPSREASSLGS QSYEDMRGILYAAPQLHSIQSGPSHEEDADSYENMDKSDDLEPAWEGEGHMGTWGTT myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 60.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_033974 |
Locus ID | 12478 |
UniProt ID | P25918, Q3TQG5 |
Cytogenetics | 7 69.01 cM |
Refseq Size | 2440 |
Refseq ORF | 1641 |
Synonyms | AW495831 |
Summary | Functions as coreceptor for the B-cell antigen receptor complex (BCR) on B-lymphocytes. Decreases the threshold for activation of downstream signaling pathways and for triggering B-cell responses to antigens (By similarity). Activates signaling pathways that lead to the activation of phosphatidylinositol 3-kinase and the mobilization of intracellular Ca(2+) stores (PubMed:9382888, PubMed:12387743, PubMed:20101619). Is not required for early steps during B cell differentiation in the blood marrow (PubMed:7542548, PubMed:7543183, PubMed:9317126). Required for normal differentiation of B-1 cells (PubMed:7542548, PubMed:7543183, PubMed:12387743). Required for normal B cell differentiation and proliferation in response to antigen challenges (PubMed:7542548, PubMed:9317126, PubMed:12387743). Required for normal levels of serum immunoglobulins, and for production of high-affinity antibodies in response to antigen challenge (PubMed:7542548, PubMed:7543183, PubMed:12387743).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.