B4galt5 (NM_019835) Mouse Recombinant Protein

CAT#: TP525689

Purified recombinant protein of Mouse UDP-Gal:betaGlcNAc beta 1,4-galactosyltransferase, polypeptide 5 (B4galt5), full length, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Product Images

Coomassie blue staining of purified B4galt5 protein (Cat# TP525689). The protein was produced from HEK293T cells transfected with B4galt5 cDNA clone (Cat# MR225689) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR225689 representing NM_019835
  Red=Cloning site Green=Tags(s)
  
  MRARRGLLRLPRRSLLAALFFFSLSSSLLYFVYVAPGIVNTYLFMVQAQGILLRDNVRTIGAQVYEQVVR
  SAYAKRNSSLNDSDYPLDLNHSEAFPPTTTFLPEDFTYFANHPCPERLPSMKGPIDINMSEIAMDDIHEL
  FSRDPAIKLGGHWKPADCVPRWKVAILIPFRNRHEHLPVLLRHLLPMLQRQRLQFAFYVIEQVGTQPFNR
  AMLFNVGFQEAMKDLDWDCLIFHDVDHIPESDRNYYGCGQMPRHFATKLDKYMYLLPYTEFFGGVSGLTV
  EQFRKINGFPNAFWGWGGEDDDLWNRVQNAGYSVSRPEGDTGKYKSIPHHHRGEVQFLGRYALLRKSKER
  QGLDGLNNLNYSANVTYDALYKNITVNLTPELAQVTEY
  
  myc-FLAG tag
• Tag: Myc-DDK
• Predicted MW: 45.3 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_062809
• Locus ID: 56336
• UniProt ID: Q9JMK0, Q3U7I0
• Cytogenetics: 2 H3
• Refseq Size: 4205
• Refseq ORF: 1164
• Synonyms: 9430078I07Rik; AW049941; AW539721
• Summary: Catalyzes the synthesis of lactosylceramide (LacCer) via the transfer of galactose from UDP-galactose to glucosylceramide (GlcCer) (PubMed:21057870, PubMed:23882130, PubMed:30114188). LacCer is the starting point in the biosynthesis of all gangliosides (membrane-bound glycosphingolipids) which play pivotal roles in the CNS including neuronal maturation and axonal and myelin formation (PubMed:30114188). Plays a role in the glycosylation of BMPR1A and regulation of its protein stability (PubMed:29415997). Essential for extraembryonic development during early embryogenesis (PubMed:20574042, PubMed:21057870).[UniProtKB/Swiss-Prot Function]