Malt1 (NM_172833) Mouse Recombinant Protein

CAT#: TP524110

Purified recombinant protein of Mouse mucosa associated lymphoid tissue lymphoma translocation gene 1 (Malt1), full length, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Product Images

Coomassie blue staining of purified Malt1 protein (Cat# TP524110). The protein was produced from HEK293T cells transfected with Malt1 cDNA clone (Cat# MR224110) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR224110 representing NM_172833
  Red=Cloning site Green=Tags(s)
  
  MSLWGQPLQASPPLAVRQPPTASSGPSTSPPAGATLNRLPEPLLRRLSESLDRAPEGRGWRQLAELAGSR
  GRLRLSGLDLEQCSLKVLEPEGSPSLCLLKLMGEKGCTVTELSDFLQALEHTEVLPLLNPPGLKITVNPE
  SKAVLAGQFVKLCCRATGHPFVQYQWFKMNKEIPYGNSSELVFNTVHVKDAGFYVCRVNNSSTFEFSQWS
  QLDVCDVAEVTDSFQGSMDGISESRLQICVEPRSQRLVPGSMLLLQCVAIGSPMPHYQWFKDESPLTHET
  KKHYTVPYVDIEHEGTYWCHVYNDRDSQDSKKAEVTIDELNNLGHPDNKEQTGQPLAKDKVALLIGNMSY
  WEHPKLKAPLVDVYELTNLLRQLDFKVVSLLDLTEYEMCNAVDEFLLLLDKGVYGLLYYAGHGYENFGNS
  FMVPVDAPNPYRSENCLCVQNILKLMQEKETGLNVFLLDMCRKRNDYDDTIPILDALKVTANIVFGYATC
  QGAEAFEIQHSGLANGIFMKFLKDRLLEDKKITVLLDEVAEDMGKCHLTKGRQALEIRSSLSEKRALTDP
  VQGAPCSAEALVRNLQWAKAHELPESMCLKFQCGVHIQLGFAAEFSNVMIIYTSIVHKPPEIIMCDAYVT
  DFPLDLDIDPKHANKGTPEETGSYLVSKDLPKHCLYTRLSSLQKLKEHLIFTVCLSYQYSGLEDTVEEKQ
  EVNVGKPLIAKLDMHRGLGRKTCFQACRMPDEPYHSSTSTSAGAGHFHSSQDSFHDVYHSHLGNADSGMP
  PDRCHCSRTPHTFISNYPPHHYCQFGRSNVPVETTDEMPFSFSDRLMISEN
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 92.5 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for at least 3 months from receipt of products under proper storage and handling conditions.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_766421
• Locus ID: 240354
• UniProt ID: Q2TBA3
• Cytogenetics: 18 E1
• Refseq Size: 5008
• Refseq ORF: 2463
• Synonyms: A630046N12; D430033E09Rik; Pcasp1
• Summary: Enhances BCL10-induced activation of NF-kappa-B. Involved in nuclear export of BCL10. Binds to TRAF6, inducing TRAF6 oligomerization and activation of its ligase activity. Has ubiquitin ligase activity (By similarity). MALT1-dependent BCL10 cleavage plays an important role in T-cell antigen receptor-induced integrin adhesion (By similarity). Involved in the induction of T helper 17 cells (Th17) differentiation. Cleaves RC3H1 and ZC3H12A in response to T-cell receptor (TCR) stimulation which releases their cooperatively repressed targets to promote Th17 cell differentiation (PubMed:25282160).[UniProtKB/Swiss-Prot Function]