Spaca3 (NM_029367) Mouse Recombinant Protein

CAT#: TP519897

Purified recombinant protein of Mouse sperm acrosome associated 3 (Spaca3), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR219897 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MEARSRAPRRQLCPPGITWLALAYLLSCLLASSKAKVFSRCELAKEMHDFGLDGYRGYNLADWVCLAYYT
  SGFNTNAVDHEADGSTNNGIFQISSRRWCRTLASNGPNLCRIYCTDLLNNDLKDSIVCAMKIVQEPLGLG
  YWEAWRHHCQGRDLSDWVDGCDF
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 18.4 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_083643
• Locus ID: 75622
• UniProt ID: Q9D9X8, A0A077S9M6
• Cytogenetics: 11 B5
• Refseq Size: 941
• Refseq ORF: 492
• Synonyms: 1700025M08Rik; ALLP17; Lyc3; mSLLP1; SLLP1
• Summary: Sperm surface membrane protein that may be involved in sperm-egg plasma membrane adhesion and fusion during fertilization. It could be a potential receptor for the egg oligosaccharide residue N-acetylglucosamine, which is present in the extracellular matrix over the egg plasma membrane. The processed form has no detectable bacteriolytic activity in vitro (By similarity).[UniProtKB/Swiss-Prot Function]