Glb1 (NM_009752) Mouse Recombinant Protein

CAT#: TP509735

Purified recombinant protein of Mouse galactosidase, beta 1 (Glb1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Product Images

Purified recombinant protein Glb1 was analyzed by SDS-PAGE gel and Coomossie Blue Staining.

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR209735 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MLRVPLCTPLPLLALLQLLGAAHGIYNVTQRTFKLDYSRDRFLKDGQPFRYISGSIHYFRIPRFYWEDRL
  LKMKMAGLNAIQMYVPWNFHEPQPGQYEFSGDRDVEHFIQLAHELGLLVILRPGPYICAEWDMGGLPAWL
  LEKQSIVLRSSDPDYLVAVDKWLAVLLPKMKPLLYQNGGPIITVQVENEYGSYFACDYDYLRFLVHRFRY
  HLGNDVILFTTDGASEKMLKCGTLQDLYATVDFGTGNNITQAFLVQRKFEPKGPLINSEFYTGWLDHWGK
  PHSTVKTKTLATSLYNLLARGANVNLYMFIGGTNFAYWNGANTPYEPQPTSYDYDAPLSEAGDLTKKYFA
  LREVIQMFKEVPEGPIPPSTPKFAYGKVALRKFKTVAEALGILCPNGPVKSLYPLTFTQVKQYFGYVLYR
  TTLPQDCSNPKPIFSSPFNGVRDRAYVSVDGVPQGILDRNLMTALNIQGKAGATLDILVENMGRVNYGRF
  INDFKGLISNMTINSTVLTNWTVFPLDTEAMVRNHLWGREASDGGHLDGRSTSNSSDLILPTFYVGNFSI
  PSGIPDLPQDTFIQFPGWSKGQVWINGFNLGRYWPTMGPQKTLFVPRNILTTSAPNNITVLELEFAPCSE
  GTPELCTVEFVDTPVIS
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 73 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_033882
• Locus ID: 12091
• UniProt ID: P23780, Q3TAW7
• Cytogenetics: 9 64.4 cM
• Refseq Size: 2396
• Refseq ORF: 1944
• Synonyms: AW125515; Bg; Bge; Bgl; Bgl-; Bgl-e; Bgl-s; Bgl-t; Bgs; Bgt; C130097A14Rik
• Summary: This gene encodes a preproprotein that is proteolytically cleaved to yield a signal peptide and a proproptein that is subsequently processed to generate the active mature peptide. The encoded protein is a lysosomal enzyme that catalyzes the hydrolysis of terminal beta-D-galactose residues in various substrates like lactose, ganglioside GM1 and other glycoproteins. Mutations in the human gene are associated with GM1-gangliosidosis and Morquio B syndrome. Disruption of the mouse gene mirrors the symptoms of human gangliosidosis. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2013]