Ing3 (NM_023626) Mouse Recombinant Protein
CAT#: TP506480
Purified recombinant protein of Mouse inhibitor of growth family, member 3 (Ing3), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Product Images
Frequently bought together (1)
Other products for "Ing3"
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR206480 protein sequence
Red=Cloning site Green=Tags(s) MIEQLPMDLRDRFTEMREMDLQVQNAMDQLEQRVSEFFMNAKKNKPEWREEQMASIKKDYYKALEDADEK VQLANQIYDLVDRHLRKLDQELAKFKMELEADNAGITEILERRSLELDAPSQPVNNHHAHSHTPVEKRKY NPTSHHAAADHIPEKKFKSEALLSTLTSDASKENTLGCRNNNSTASCNNAYNVNSSQPLASYNIGSLSSG AGAGAITMAAAQAVQATAQMKEGRRTSSLKASYEAFKNNDFQLGKEFSIPRETAGYSSSSALMTTLTQNA SSSATDSRSGRKSKNNTKSSSQQSSSSSSSSSSSSLSLCSSSSTVVQEVSQQATVVPESDSNSQVDWTYD PNEPRYCICNQVSYGEMVGCDNQDCPIEWFHYGCVGLTEAPKGKWFCPQCTAAMKRRGSRHK myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 45.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_076115 |
Locus ID | 71777 |
UniProt ID | Q8VEK6 |
Cytogenetics | 6 A3.1 |
Refseq Size | 3755 |
Refseq ORF | 1239 |
Synonyms | 1300013A07Rik; P47ING3 |
Summary | Component of the NuA4 histone acetyltransferase (HAT) complex which is involved in transcriptional activation of select genes principally by acetylation of nucleosomal histones H4 and H2A. This modification may both alter nucleosome - DNA interactions and promote interaction of the modified histones with other proteins which positively regulate transcription. This complex may be required for the activation of transcriptional programs associated with oncogene and proto-oncogene mediated growth induction, tumor suppressor mediated growth arrest and replicative senescence, apoptosis, and DNA repair. NuA4 may also play a direct role in DNA repair when directly recruited to sites of DNA damage. Component of a SWR1-like complex that specifically mediates the removal of histone H2A.Z/H2AFZ from the nucleosome (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.