Dcun1d5 (NM_029775) Mouse Recombinant Protein

CAT#: TP502903

Purified recombinant protein of Mouse DCN1, defective in cullin neddylation 1, domain containing 5 (S. cerevisiae) (Dcun1d5), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR202903 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MPVKKKRKAPGVAAAVAEDAGLKKCKIPSYCRSQPPARLISGEEDFSRKKCLAWFYEYAGPDEVVGPEGM
  EKFCEDIGVEPENIIMLVLAWKLEAESMGFFTKEEWLKGMTSLQCDCTEKLQSRFDFLRSQLNDISSFKN
  IYRYAFDFARDKDQRSLDIDTAKSMLALLLGRTWPLFSVFYQYLEQSKYRVMNKDQWYNVLEFSRTVHAD
  LSNYDEDGAWPVLLDEFVEWQKIRQTS
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 27.6 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_084051
• Locus ID: 76863
• UniProt ID: Q9CXV9
• Cytogenetics: 9 A1
• Refseq Size: 1201
• Refseq ORF: 714
• Synonyms: 3110001A18Rik; 4833420K19Rik; AW060460; D430047L21Rik
• Summary: Contributes to the neddylation of all cullins by transfering NEDD8 from N-terminally acetylated NEDD8-conjugating E2s enzyme to different cullin C-terminal domain-RBX complexes which is necessary for the activation of cullin-RING E3 ubiquitin ligases (CRLs). May play a role in DNA damage response and may participate to cell proliferation and anchorage-independent cell growth.[UniProtKB/Swiss-Prot Function]