Maff (NM_010755) Mouse Recombinant Protein
CAT#: TP501170
Purified recombinant protein of Mouse v-maf musculoaponeurotic fibrosarcoma oncogene family, protein F (avian) (Maff), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Product Images
Frequently bought together (1)
Other products for "Maff"
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR201170 protein sequence
Red=Cloning site Green=Tags(s) MAVDPLSSKALKVKRELSENTPHLSDEALMGLSVRELNRNLRGLSAEEVTRLKQRRRTLKNRGYAASCRV KRVCQKEELQKQKSELEREVDKLARENAAMRLELDALRGKCEALQGFARSVAAARGPAALVAPASVITIV KSAPGPAPAADPAPCS myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 17 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_034885 |
Locus ID | 17133 |
UniProt ID | O54791, Q3U0G5 |
Cytogenetics | 15 37.7 cM |
Refseq Size | 1800 |
Refseq ORF | 471 |
Summary | Since they lack a putative transactivation domain, the small Mafs behave as transcriptional repressors when they dimerize among themselves. However, they seem to serve as transcriptional activators by dimerizing with other (usually larger) basic-zipper proteins, such as NFE2L1/NRF1, and recruiting them to specific DNA-binding sites. Interacts with the upstream promoter region of the oxytocin receptor gene. May be a transcriptional enhancer in the up-regulation of the oxytocin receptor gene at parturition.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.