Maff (NM_010755) Mouse Recombinant Protein

CAT#: TP501170

Purified recombinant protein of Mouse v-maf musculoaponeurotic fibrosarcoma oncogene family, protein F (avian) (Maff), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR201170 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAVDPLSSKALKVKRELSENTPHLSDEALMGLSVRELNRNLRGLSAEEVTRLKQRRRTLKNRGYAASCRV
  KRVCQKEELQKQKSELEREVDKLARENAAMRLELDALRGKCEALQGFARSVAAARGPAALVAPASVITIV
  KSAPGPAPAADPAPCS
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 17 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_034885
• Locus ID: 17133
• UniProt ID: O54791, Q3U0G5
• Cytogenetics: 15 37.7 cM
• Refseq Size: 1800
• Refseq ORF: 471
• Summary: Since they lack a putative transactivation domain, the small Mafs behave as transcriptional repressors when they dimerize among themselves. However, they seem to serve as transcriptional activators by dimerizing with other (usually larger) basic-zipper proteins, such as NFE2L1/NRF1, and recruiting them to specific DNA-binding sites. Interacts with the upstream promoter region of the oxytocin receptor gene. May be a transcriptional enhancer in the up-regulation of the oxytocin receptor gene at parturition.[UniProtKB/Swiss-Prot Function]