Maff (NM_010755) Mouse Tagged ORF Clone

CAT#: MR201170

Maff (Myc-DDK-tagged) - Mouse v-maf musculoaponeurotic fibrosarcoma oncogene family, protein F (avian) (Maff)

  • TrueORF®

Need custom modification / cloning service?
Get a free quote

Mouse Protein / Lysate Request

USD 48.00

USD 390.00


Availability*
In Stock

Size
    • 10 ug

Cited in 1 publication.

Product images

Specifications

Product Data
Product Name Maff (NM_010755) Mouse Tagged ORF Clone
Symbol Maff
Vector pCMV6-Entry
Sequence Data
>MR201170 representing NM_010755
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTGTGGATCCCTTATCTAGCAAAGCCCTGAAGGTCAAGCGCGAGTTGAGCGAGAACACGCCGCACC
TGTCGGATGAAGCGCTGATGGGGCTGTCGGTGCGCGAGCTGAACCGCAACCTGCGCGGGCTGTCGGCGGA
GGAGGTGACGCGGCTGAAGCAGCGGCGCCGCACACTCAAGAACCGCGGCTACGCGGCCAGCTGCCGCGTG
AAGCGCGTGTGCCAGAAGGAGGAGCTGCAGAAGCAGAAGTCCGAGCTGGAGCGCGAGGTGGACAAGCTGG
CGCGCGAGAACGCCGCCATGCGCCTGGAGCTCGACGCGCTGCGCGGCAAGTGTGAAGCGCTGCAGGGCTT
CGCGCGCTCCGTGGCCGCCGCCCGCGGGCCCGCCGCACTGGTGGCGCCCGCCAGCGTCATCACCATCGTC
AAGTCGGCGCCGGGCCCAGCCCCTGCTGCTGACCCCGCCCCCTGCTCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR201170 representing NM_010755
Red=Cloning site Green=Tags(s)

MAVDPLSSKALKVKRELSENTPHLSDEALMGLSVRELNRNLRGLSAEEVTRLKQRRRTLKNRGYAASCRV
KRVCQKEELQKQKSELEREVDKLARENAAMRLELDALRGKCEALQGFARSVAAARGPAALVAPASVITIV
KSAPGPAPAADPAPCS

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_010755
ORF Size 468 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_010755.1, NM_010755.2, NM_010755.3, NM_010755.4, NP_034885
RefSeq Size 1800
RefSeq ORF 471
Locus ID 17133
Cytogenetics 15 E1|15 37.7 cM
MW 17.4 kDa
Gene Summary Interacts with the upstream promoter region of the oxytocin receptor gene. May be a transcriptional enhancer in the up-regulation of the oxytocin receptor gene at parturition. Since it lacks a putative transactivation domain, it may behave as a transcriptional repressor when it self-dimerizes. May also serve as a transcriptional activator by dimerizing with other (usually larger) basic-zipper proteins and recruiting them to specific DNA-binding sites. May be involved in the cellular stress response. [UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)