SENP8 (NM_001166340) Human Recombinant Protein

CAT#: TP329692M

Recombinant protein of human SUMO/sentrin specific peptidase family member 8 (SENP8), transcript variant 1, 100 µg

Product Images

Coomassie blue staining of purified SENP8 protein (Cat# TP329692). The protein was produced from HEK293T cells transfected with SENP8 cDNA clone (Cat# RC229692) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC229692 representing NM_001166340
  Red=Cloning site Green=Tags(s)
  
  MDPVVLSYMDSLLRQSDVSLLDPPSWLNDHIIGFAFEYFANSQFHDCSDHVSFISPEVTQFIKCTSNPAE
  IAMFLEPLDLPNKRVVFLAINDNSNQAAGGTHWSLLVYLQDKNSFFHYDSHSRSNSVHAKQVAEKLEAFL
  GRKGDKLAFVEEKAPAQQNSYDCGMYVICNTEALCQNFFRQQTESLLQLLTPAYITKKRGEWKDLIATLA
  KK
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 24.6
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: NULL or Add: Recombinant proteins was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001159812
• Locus ID: 123228
• UniProt ID: Q96LD8
• Cytogenetics: 15q23
• Refseq ORF: 636
• Synonyms: DEN1; NEDP1; PRSC2
• Summary: This gene encodes a cysteine protease that is a member of the sentrin-specific protease family. The encoded protein is involved in processing and deconjugation of the ubiquitin-like protein termed, neural precursor cell expressed developmentally downregulated 8. Alternate splicing results in multiple transcript variants.[provided by RefSeq, Oct 2009]
• Protein Families: Druggable Genome, Protease