FAM3A (NM_001171133) Human Recombinant Protein
CAT#: TP329664
Purified recombinant protein of Homo sapiens family with sequence similarity 3, member A (FAM3A), transcript variant 3, 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC229664 representing NM_001171133
Red=Cloning site Green=Tags(s) MRLAGPESSVTAAPRARKYKCGLPQPCPEEHLAFRVVSGAANVIGPKICLEDKMLMSSVKDNVGRGLNIA LVNGVSGELIEARAFDMWAGDVNDLLKFIRPLHEGTLVFVASYDDPATKMNEETRKLFSELGSRNAKELA FRDSWVFVGAKGVQNKSPFEQHVKNSKHSNKYEGWPEALEMEGCIPRRSTAS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 21.6 |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | NULL or Add: Recombinant proteins was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001164604 |
Locus ID | 60343 |
UniProt ID | P98173 |
Cytogenetics | Xq28 |
Refseq ORF | 576 |
Synonyms | 2.19; DLD; DXS560S; XAP-7 |
Summary | This gene encodes a cytokine-like protein. The expression of this gene may be regulated by peroxisome proliferator-activated receptor gamma, and the encoded protein may be involved in the regulation of glucose and lipid metabolism. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2013] |
Protein Families | Secreted Protein, Transmembrane |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC411913 | FAM3A HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC432664 | FAM3A HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY411913 | Transient overexpression lysate of family with sequence similarity 3, member A (FAM3A), transcript variant 1 |
USD 436.00 |
|
LY432664 | Transient overexpression lysate of family with sequence similarity 3, member A (FAM3A), transcript variant 3 |
USD 436.00 |
|
PH303495 | FAM3A MS Standard C13 and N15-labeled recombinant protein (NP_068578) |
USD 3,255.00 |
|
TP303495 | Recombinant protein of human family with sequence similarity 3, member A (FAM3A), 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review