FAM3A (NM_001171133) Human Recombinant Protein

CAT#: TP329664M

Purified recombinant protein of Homo sapiens family with sequence similarity 3, member A (FAM3A), transcript variant 3, 100 µg

Product Images

Coomassie blue staining of purified FAM3A protein (Cat# TP329664). The protein was produced from HEK293T cells transfected with FAM3A cDNA clone (Cat# RC229664) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC229664 representing NM_001171133
  Red=Cloning site Green=Tags(s)
  
  MRLAGPESSVTAAPRARKYKCGLPQPCPEEHLAFRVVSGAANVIGPKICLEDKMLMSSVKDNVGRGLNIA
  LVNGVSGELIEARAFDMWAGDVNDLLKFIRPLHEGTLVFVASYDDPATKMNEETRKLFSELGSRNAKELA
  FRDSWVFVGAKGVQNKSPFEQHVKNSKHSNKYEGWPEALEMEGCIPRRSTAS
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 21.6
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: NULL or Add: Recombinant proteins was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001164604
• Locus ID: 60343
• UniProt ID: P98173
• Cytogenetics: Xq28
• Refseq ORF: 576
• Synonyms: 2.19; DLD; DXS560S; XAP-7
• Summary: This gene encodes a cytokine-like protein. The expression of this gene may be regulated by peroxisome proliferator-activated receptor gamma, and the encoded protein may be involved in the regulation of glucose and lipid metabolism. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2013]
• Protein Families: Secreted Protein, Transmembrane