ZNF447 (ZSCAN18) (NM_001145543) Human Recombinant Protein

CAT#: TP327637

Recombinant protein of human zinc finger and SCAN domain containing 18 (ZSCAN18), transcript variant 4, 20 µg

Product Images

Coomassie blue staining of purified ZSCAN18 protein (Cat# TP327637). The protein was produced from HEK293T cells transfected with ZSCAN18 cDNA clone (Cat# RC227637) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC227637 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MLPLEKAFASPRSSPAPPDLPTPGSAAGVQQEEPETIPERTPADLEFSRLRFREFVYQEAAGPHQTLARL
  HELCRQWLMPEARSKEQMLELLVLEQFLGILPDKVRPWVVAQYPESCKKAASLVEGLADVLEEPGMLLGS
  PAGSSSILSDGVYERHMDPLLLPGELASPSQALGAGEIPAPSETPWLSPDPLFLEQRRVREAKTEEDGPA
  NTEQKLKSFPEDPQHLGEWGHLDPAEENLKSYRKLLLWGYQLSQPDAASRLDTEELRLVERDPQGSSLPE
  GGRRQESAGCACEEAAPAGVLPELPTEAPPGDALADPPSGTTEEEEEQPGKAPDPQDPQDAESDSATGSQ
  RQSVIQQPAPDRGTAKLGTKRPHPEDGDEQSLEGVSSSGDSAGLEAGQGPGADEPGLSRGKPYACGECGE
  AFAWLSHLMEHHSSHGGRKRYACQGCWKTFHFSLALAEHQKTHEKEKSYALGGARGPQPSTREAQAGARA
  GGPPESVEGEAPPAPPEAQR
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 54.6 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001139015
• Locus ID: 65982
• UniProt ID: Q8TBC5, A0A024R4T0
• Cytogenetics: 19q13.43
• Refseq Size: 2716
• Refseq ORF: 1530
• Synonyms: ZNF447
• Summary: May be involved in transcriptional regulation.[UniProtKB/Swiss-Prot Function]
• Protein Families: Transcription Factors