RNASEH2B (NM_001142279) Human Recombinant Protein

CAT#: TP326833

Recombinant protein of human ribonuclease H2, subunit B (RNASEH2B), transcript variant 2, 20 µg

Product Images

Coomassie blue staining of purified RNASEH2B protein (Cat# TP326833). The protein was produced from HEK293T cells transfected with RNASEH2B cDNA clone (Cat# RC226833) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC226833 representing NM_001142279
  Red=Cloning site Green=Tags(s)
  
  MAAGVDCGDGVGARQHVFLVSEYLKDASKKMKNGLMFVKLVNPCSGEGAIYLFNMCLQQLFEVKVFKEKH
  HSWFINQSVQSGGLLHFATPVDPLFLLLHYLIKADKEGKFQPLDQVVVDNVFPNCILLLKLPGLEKLLHH
  VTEEKGNPEIDNKKYYKYSKEKTLKWLEKKVNQTVAALKTNNVNVSSRVQSTAFFSGDQASTDKEEDYIR
  YAHGLISDYIPKELSDDLSKYLKLPEPSASLPNPPSKMAAQRQKRGK
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 28.8 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001135751
• Locus ID: 79621
• UniProt ID: Q5TBB1
• Cytogenetics: 13q14.3
• Refseq ORF: 771
• Synonyms: AGS2; DLEU8
• Summary: RNase H2 is composed of a single catalytic subunit (A) and two non-catalytic subunits (B and C) and specifically degrades the RNA of RNA:DNA hybrids. The protein encoded by this gene is the non-catalytic B subunit of RNase H2, which is thought to play a role in DNA replication. Multiple transcript variants encoding different isoforms have been found for this gene. Defects in this gene are a cause of Aicardi-Goutieres syndrome type 2 (AGS2). [provided by RefSeq, Nov 2008]
• Protein Pathways: DNA replication