MTHFD2 (MTHFD2L) (NM_001144978) Human Recombinant Protein

CAT#: TP326798

Recombinant protein of human methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 2-like (MTHFD2L), 20 µg

Product Images

Coomassie blue staining of purified MTHFD2L protein (Cat# TP326798). The protein was produced from HEK293T cells transfected with MTHFD2L cDNA clone (Cat# RC226798) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC226798 representing NM_001144978
  Red=Cloning site Green=Tags(s)
  
  MTVPVRGFSLLRGRLGRAPALGRSTAPSVRAPGEPGSAFRGFRSSGVRHEAIIISGTEMAKHIQKEIQRG
  VESWVSLGNRRPHLSIILVGDNPASHTYVRNKIRAASAVGICSELILKPKDVSQEELLDVTDQLNMDPRV
  SGILVQLPLPDHVDERTICNGIAPEKDVDGFHIINIGRLCLDQHSLIPATASAVWEIIKRTGIQTFGKNV
  VVAGRSKNVGMPIAMLLHTDGEHERPGGDATVTIAHRYTPKEQLKIHTQLADIIIVAAGIPKLITSDMVK
  EGAAVIDVGINYVHDPVTGKTKLVGDVDFEAVKKKAGFITPVPGGVGPMTVAMLLKNTLLAAKKIIY
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 37.1 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001138450
• Locus ID: 441024
• UniProt ID: Q9H903
• Cytogenetics: 4q13.3
• Refseq ORF: 1041