FXYD2 (NM_001127489) Human Recombinant Protein

CAT#: TP325122L

Recombinant protein of human FXYD domain containing ion transport regulator 2 (FXYD2), transcript variant c, 1 mg

Size: 20 ug 100 ug 1 mg


USD 9,200.00

6 Weeks*

Size
    • 1 mg

Product Images

Frequently bought together (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

USD 471.00

Other products for "FXYD2"

Specifications

Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>RC225122 representing NM_001127489
Red=Cloning site Green=Tags(s)

MTGLSMDGGGSPKGDVDPFYYGKPGPLRTLPEPSGPLPPSSGLSQPQVHALCPLSPLVTTGCCGQAAERD
SCWERPPIPLLLPSLSGDYETVRNGGLIFAGLAFIVGLLILLSKWGGLQGRGADQGTSLLKAAEQAGFRE
LPREG

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 14.9 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_001120961
Locus ID 486
UniProt ID P54710
Cytogenetics 11q23.3
Refseq ORF 435
Synonyms ATP1G1; HOMG2; MGC12372
Summary This gene encodes a member of the FXYD family of transmembrane proteins. This particular protein encodes the sodium/potassium-transporting ATPase subunit gamma. Mutations in this gene have been associated with Renal Hypomagnesemia-2. Alternatively spliced transcript variants have been described. Read-through transcripts have been observed between this locus and the upstream FXYD domain-containing ion transport regulator 6 (FXYD6, GeneID 53826) locus.[provided by RefSeq, Feb 2011]
Protein Families Druggable Genome, Ion Channels: Other, Transmembrane

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.