FXYD2 (NM_001127489) Human Recombinant Protein
CAT#: TP325122
Recombinant protein of human FXYD domain containing ion transport regulator 2 (FXYD2), transcript variant c, 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC225122 representing NM_001127489
Red=Cloning site Green=Tags(s) MTGLSMDGGGSPKGDVDPFYYGKPGPLRTLPEPSGPLPPSSGLSQPQVHALCPLSPLVTTGCCGQAAERD SCWERPPIPLLLPSLSGDYETVRNGGLIFAGLAFIVGLLILLSKWGGLQGRGADQGTSLLKAAEQAGFRE LPREG myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 14.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001120961 |
Locus ID | 486 |
UniProt ID | P54710 |
Cytogenetics | 11q23.3 |
Refseq ORF | 435 |
Synonyms | ATP1G1; HOMG2; MGC12372 |
Summary | This gene encodes a member of the FXYD family of transmembrane proteins. This particular protein encodes the sodium/potassium-transporting ATPase subunit gamma. Mutations in this gene have been associated with Renal Hypomagnesemia-2. Alternatively spliced transcript variants have been described. Read-through transcripts have been observed between this locus and the upstream FXYD domain-containing ion transport regulator 6 (FXYD6, GeneID 53826) locus.[provided by RefSeq, Feb 2011] |
Protein Families | Druggable Genome, Ion Channels: Other, Transmembrane |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC411967 | FXYD2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC419804 | FXYD2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC426799 | FXYD2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY411967 | Transient overexpression lysate of FXYD domain containing ion transport regulator 2 (FXYD2), transcript variant b |
USD 436.00 |
|
LY419804 | Transient overexpression lysate of FXYD domain containing ion transport regulator 2 (FXYD2), transcript variant a |
USD 436.00 |
|
LY426799 | Transient overexpression lysate of FXYD domain containing ion transport regulator 2 (FXYD2), transcript variant c |
USD 436.00 |
|
PH302739 | FXYD2 MS Standard C13 and N15-labeled recombinant protein (NP_067614) |
USD 3,255.00 |
|
PH305076 | FXYD2 MS Standard C13 and N15-labeled recombinant protein (NP_001671) |
USD 3,255.00 |
|
PH325122 | FXYD2 MS Standard C13 and N15-labeled recombinant protein (NP_001120961) |
USD 3,255.00 |
|
TP302739 | Recombinant protein of human FXYD domain containing ion transport regulator 2 (FXYD2), transcript variant b, 20 µg |
USD 867.00 |
|
TP305076 | Recombinant protein of human FXYD domain containing ion transport regulator 2 (FXYD2), transcript variant a, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review