PGRP1B (PGLYRP4) (NM_020393) Human Recombinant Protein

CAT#: TP324039

Purified recombinant protein of Homo sapiens peptidoglycan recognition protein 4 (PGLYRP4), 20 µg

Product Images

Coomassie blue staining of purified PGLYRP4 protein (Cat# TP324039). The protein was produced from HEK293T cells transfected with PGLYRP4 cDNA clone (Cat# RC224039) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC224039 representing NM_020393
  Red=Cloning site Green=Tags(s)
  
  MLPWLLVFSALGIQAWGDSSWNKTQAKQVSEGLQYLFENISQLTEKGLPTDVSTTVSRKAWGAEAVGCSI
  QLTTPVNVLVIHHVPGLECHDQTVCSQRLRELQAHHVHNNSGCDVAYNFLVGDDGRVYEGVGWNIQGVHT
  QGYNNISLGFAFFGTKKGHSPSPAALSAMENLITYAVQKGHLSSSYVQPLLGKGENCLAPRQKTSLKKAC
  PGVVPRSVWGARETHCPRMTLPAKYGIIIHTAGRTCNISDECRLLVRDIQSFYIDRLKSCDIGYNFLVGQ
  DGAIYEGVGWNVQGSSTPGYDDIALGITFMGTFTGIPPNAAALEAAQDLIQCAMVKGYLTPNYLLVGHSD
  VARTLSPGQALYNIISTWPHFKH
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 38.7 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_065126
• Locus ID: 57115
• UniProt ID: Q96LB8
• Cytogenetics: 1q21.3
• Refseq Size: 1853
• Refseq ORF: 1119
• Synonyms: PGLYRPIbeta; PGRP-Ibeta; PGRPIB; SBBI67
• Summary: Summary: This gene encodes a peptidoglycan recognition protein, which belongs to the N-acetylmuramoyl-L-alanine amidase 2 family. These proteins are part of the innate immune system and recognize peptidoglycan, a ubiquitous component of bacterial cell walls. This antimicrobial protein binds to murein peptidoglycans of Gram-positive bacteria. [provided by RefSeq, Oct 2014]
• Protein Families: Druggable Genome