PEDS1 (NM_199129) Human Recombinant Protein
CAT#: TP324011
Recombinant protein of human transmembrane protein 189 (TMEM189), 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC224011 representing NM_199129
Red=Cloning site Green=Tags(s) MAGAEDWPGQQLELDEDEASCCRWGAQHAGARELAALYSPGKRLQEWCSVILCFSLIAHNLVHLLLLARW EDTPLVILGVVAGALIADFLSGLVHWGADTWGSVELPIVGKAFIRPFREHHIDPTAITRHDFIETNGDNC LVTLLPLLNMAYKFRTHSPEALEQLYPWECFVFCLIIFGTFTNQIHKWSHTYFGLPRWVTLLQDWHVILP RKHHRIHHVSPHETYFCITTGWLNYPLEKIGFWRRLEDLIQGLTGEKPRADDMKWAQKIK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 31 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_954580 |
Locus ID | 387521 |
UniProt ID | A5PLL7 |
Cytogenetics | 20q13.13 |
Refseq Size | 2187 |
Refseq ORF | 810 |
Synonyms | CarF; KUA; TMEM189 |
Summary | Co-transcription of this gene and the neighboring downstream gene (ubiquitin-conjugating enzyme E2 variant 1) generates a rare read-through transcript, which encodes a fusion protein comprised of sequence sharing identity with each individual gene product. The protein encoded by this individual gene lacks a UEV1 domain but includes three transmembrane regions. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jun 2009] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC404743 | TMEM189 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY404743 | Transient overexpression lysate of transmembrane protein 189 (TMEM189), transcript variant 1 |
USD 436.00 |
|
PH324011 | TMEM189 MS Standard C13 and N15-labeled recombinant protein (NP_954580) |
USD 3,255.00 |
{0} Product Review(s)
Be the first one to submit a review