PEDS1 (NM_199129) Human Recombinant Protein

CAT#: TP324011

Recombinant protein of human transmembrane protein 189 (TMEM189), 20 µg

Product Images

Coomassie blue staining of purified TMEM189 protein (Cat# TP324011). The protein was produced from HEK293T cells transfected with TMEM189 cDNA clone (Cat# RC224011) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC224011 representing NM_199129
  Red=Cloning site Green=Tags(s)
  
  MAGAEDWPGQQLELDEDEASCCRWGAQHAGARELAALYSPGKRLQEWCSVILCFSLIAHNLVHLLLLARW
  EDTPLVILGVVAGALIADFLSGLVHWGADTWGSVELPIVGKAFIRPFREHHIDPTAITRHDFIETNGDNC
  LVTLLPLLNMAYKFRTHSPEALEQLYPWECFVFCLIIFGTFTNQIHKWSHTYFGLPRWVTLLQDWHVILP
  RKHHRIHHVSPHETYFCITTGWLNYPLEKIGFWRRLEDLIQGLTGEKPRADDMKWAQKIK
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 31 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_954580
• Locus ID: 387521
• UniProt ID: A5PLL7
• Cytogenetics: 20q13.13
• Refseq Size: 2187
• Refseq ORF: 810
• Synonyms: CarF; KUA; TMEM189
• Summary: Co-transcription of this gene and the neighboring downstream gene (ubiquitin-conjugating enzyme E2 variant 1) generates a rare read-through transcript, which encodes a fusion protein comprised of sequence sharing identity with each individual gene product. The protein encoded by this individual gene lacks a UEV1 domain but includes three transmembrane regions. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jun 2009]
• Protein Families: Transmembrane