PEDS1 (NM_199129) Human Mass Spec Standard

CAT#: PH324011

TMEM189 MS Standard C13 and N15-labeled recombinant protein (NP_954580)

Product Images

Coomassie blue staining of purified TMEM189 protein (Cat# TP324011). The protein was produced from HEK293T cells transfected with TMEM189 cDNA clone (Cat# RC224011) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC224011
• Predicted MW: 31 kDa
• Protein Sequence:
  Sequence Link

  >RC224011 representing NM_199129
  Red=Cloning site Green=Tags(s)
  
  MAGAEDWPGQQLELDEDEASCCRWGAQHAGARELAALYSPGKRLQEWCSVILCFSLIAHNLVHLLLLARW
  EDTPLVILGVVAGALIADFLSGLVHWGADTWGSVELPIVGKAFIRPFREHHIDPTAITRHDFIETNGDNC
  LVTLLPLLNMAYKFRTHSPEALEQLYPWECFVFCLIIFGTFTNQIHKWSHTYFGLPRWVTLLQDWHVILP
  RKHHRIHHVSPHETYFCITTGWLNYPLEKIGFWRRLEDLIQGLTGEKPRADDMKWAQKIK
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_954580
• RefSeq Size: 2187
• RefSeq ORF: 810
• Synonyms: CarF; KUA; TMEM189
• Locus ID: 387521
• UniProt ID: A5PLL7
• Cytogenetics: 20q13.13
• Summary: Co-transcription of this gene and the neighboring downstream gene (ubiquitin-conjugating enzyme E2 variant 1) generates a rare read-through transcript, which encodes a fusion protein comprised of sequence sharing identity with each individual gene product. The protein encoded by this individual gene lacks a UEV1 domain but includes three transmembrane regions. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jun 2009]
• Protein Families: Transmembrane