SERPINB8 (NM_002640) Human Recombinant Protein
CAT#: TP323880
Recombinant protein of human serpin peptidase inhibitor, clade B (ovalbumin), member 8 (SERPINB8), transcript variant 1, 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC223880 representing NM_002640
Red=Cloning site Green=Tags(s) MDDLCEANGTFAISLFKILGEEDNSRNVFFSPMSISSALAMVFMGAKGSTAAQMSQALCLYKDGDIHRGF QSLLSEVNRTGTQYLLRTANRLFGEKTCDFLPDFKEYCQKFYQAELEELSFAEDTEECRKHINDWVAEKT EGKISEVLDAGTVDPLTKLVLVNAIYFKGKWNEQFDRKYTRGMLFKTNEEKKTVQMMFKEAKFKMGYADE VHTQVLELPYVEEELSMVILLPDDNTDLAVVEKALTYEKFKAWTNSEKLTKSKVQVFLPRLKLEESYDLE PFLRRLGMIDAFDEAKADFSGMSTEKNVPLSKVAHKCFVEVNEEGTEAAAATAVVRNSRCSRMEPRFCAD HPFLFFIRRHKTNCILFCGRFSSP myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 42.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_002631 |
Locus ID | 5271 |
UniProt ID | P50452, A0A024R2B1, Q8N178 |
Cytogenetics | 18q22.1 |
Refseq Size | 3390 |
Refseq ORF | 1122 |
Synonyms | C18orf53; CAP2; PI-8; PI8; PSS5 |
Summary | The protein encoded by this gene is a member of the ov-serpin family of serine protease inhibitors. The encoded protein is produced by platelets and can bind to and inhibit the function of furin, a serine protease involved in platelet functions. In addition, this protein has been found to enhance the mechanical stability of cell-cell adhesion in the skin, and defects in this gene have been associated with an autosomal-recessive form of exfoliative ichthyosis. [provided by RefSeq, Jan 2017] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC404778 | SERPINB8 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC419193 | SERPINB8 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC422205 | SERPINB8 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY404778 | Transient overexpression lysate of serpin peptidase inhibitor, clade B (ovalbumin), member 8 (SERPINB8), transcript variant 2 |
USD 436.00 |
|
LY419193 | Transient overexpression lysate of serpin peptidase inhibitor, clade B (ovalbumin), member 8 (SERPINB8), transcript variant 1 |
USD 436.00 |
|
LY422205 | Transient overexpression lysate of serpin peptidase inhibitor, clade B (ovalbumin), member 8 (SERPINB8), transcript variant 3 |
USD 436.00 |
|
PH305135 | SERPINB8 MS Standard C13 and N15-labeled recombinant protein (NP_001027018) |
USD 3,255.00 |
|
PH323880 | SERPINB8 MS Standard C13 and N15-labeled recombinant protein (NP_002631) |
USD 3,255.00 |
|
TP305135 | Recombinant protein of human serpin peptidase inhibitor, clade B (ovalbumin), member 8 (SERPINB8), transcript variant 3, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review