OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

ARMS2 (NM_001099667) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP323747
Recombinant protein of human age-related maculopathy susceptibility 2 (ARMS2), nuclear gene encoding mitochondrial protein, 20 µg
Size:
20 ug 1 mg 100 ug
  $737.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA812774 ARMS2 mouse monoclonal antibody,clone OTI2G1 100 ul
$447.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "ARMS2 or NM_001099667"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC223747 representing NM_001099667
Red=Cloning site Green=Tags(s)

MLRLYPGPMVTEAEGKGGPEMASLSSSVVPVSFISTLRESVLDPGVGGEGASDKQRSKLSLSHSMIPAAK
IHTELCLPAFFSPAGTQRRFQQPQHHLTLSIIHTAAR

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 11.3 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001093137
Locus ID 387715
UniProt ID P0C7Q2
Cytogenetics 10q26.13
RefSeq Size 823
RefSeq ORF 321
Synonyms ARMD8
Summary This gene encodes a small secreted protein specific to primates. This protein is a component of the choroidal extracellular matrix of the eye. Mutations in this gene are associated with age-related macular degeneration. provided by RefSeq, Sep 2017
Protein Categories Intracellular Proteins, Nervous system Diseases
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "ARMS2" proteins (4)
SKU Description Size Price
PH323747 ARMS2 MS Standard C13 and N15-labeled recombinant protein (NP_001093137) 10 ug
$3,360.00
LC420481 Lyophilized ARMS2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY420481 Transient overexpression lysate of age-related maculopathy susceptibility 2 (ARMS2), nuclear gene encoding mitochondrial protein (as WB positive control) 100 ug
$436.00
TP701006 Purified recombinant protein of Human age-related maculopathy susceptibility 2 (ARMS2), nuclear gene encoding mitochondrial protein, mutant (A69S), expressed in HEK293 cells, 20ug 20 ug
$900.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products