HNRPH2 (HNRNPH2) (NM_019597) Human Recombinant Protein
CAT#: TP321204
Recombinant protein of human heterogeneous nuclear ribonucleoprotein H2 (H') (HNRNPH2), transcript variant 1, 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC221204 protein sequence
Red=Cloning site Green=Tags(s) MMLSTEGREGFVVKVRGLPWSCSADEVMRFFSDCKIQNGTSGIRFIYTREGRPSGEAFVELESEEEVKLA LKKDRETMGHRYVEVFKSNSVEMDWVLKHTGPNSPDTANDGFVRLRGLPFGCSKEEIVQFFSGLEIVPNG MTLPVDFQGRSTGEAFVQFASQEIAEKALKKHKERIGHRYIEIFKSSRAEVRTHYDPPRKLMAMQRPGPY DRPGAGRGYNSIGRGAGFERMRRGAYGGGYGGYDDYGGYNDGYGFGSDRFGRDLNYCFSGMSDHRYGDGG SSFQSTTGHCVHMRGLPYRATENDIYNFFSPLNPMRVHIEIGPDGRVTGEADVEFATHEDAVAAMAKDKA NMQHRYVELFLNSTAGTSGGAYDHSYVELFLNSTAGASGGAYGSQMMGGMGLSNQSSYGGPASQQLSGGY GGGYGGQSSMSGYDQVLQENSSDYQSNLA myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 49.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_062543 |
Locus ID | 3188 |
UniProt ID | P55795, A0A384MDT2 |
Cytogenetics | Xq22.1 |
Refseq Size | 2392 |
Refseq ORF | 1347 |
Synonyms | FTP3; hnRNPH'; HNRPH'; HNRPH2; MRXSB; NRPH2 |
Summary | This gene belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein encoded by this gene has three repeats of quasi-RRM domains that binds to RNAs. It is very similar to the family member HNRPH1. This gene is thought to be involved in Fabray disease and X-linked agammaglobulinemia phenotype. Alternative splicing results in multiple transcript variants encoding the same protein. Read-through transcription between this locus and the ribosomal protein L36a gene has been observed. [provided by RefSeq, Jan 2011] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC412724 | HNRNPH2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 206.00 |
|
LC422325 | HNRNPH2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 206.00 |
|
LY412724 | Transient overexpression lysate of heterogeneous nuclear ribonucleoprotein H2 (H') (HNRNPH2), transcript variant 1 |
USD 665.00 |
|
LY422325 | Transient overexpression lysate of heterogeneous nuclear ribonucleoprotein H2 (H') (HNRNPH2), transcript variant 2 |
USD 665.00 |
|
PH321204 | HNRNPH2 MS Standard C13 and N15-labeled recombinant protein (NP_062543) |
USD 3,255.00 |
{0} Product Review(s)
Be the first one to submit a review