HNRPH2(HNRNPH2) (NM_019597) Human Tagged ORF Clone

CAT#: RC221204

HNRNPH2 (Myc-DDK-tagged)-Human heterogeneous nuclear ribonucleoprotein H2 (H') (HNRNPH2), transcript variant 1

Change vector?

USD 577


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name HNRPH2(HNRNPH2) (NM_019597) Human Tagged ORF Clone
Symbol HNRNPH2
Synonyms FTP3; hnRNPH ; HNRPH ; HNRPH2
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC221204 representing NM_019597
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGATGCTGAGCACGGAAGGCAGGGAGGGGTTCGTGGTGAAGGTCAGGGGCCTACCCTGGTCCTGCTCAG
CCGATGAAGTGATGCGCTTCTTCTCTGATTGCAAGATCCAAAATGGCACATCAGGTATTCGTTTCATCTA
CACCAGAGAAGGCAGACCAAGTGGTGAAGCATTTGTTGAACTTGAATCTGAAGAGGAAGTGAAATTGGCT
TTGAAGAAGGACAGAGAAACCATGGGACACAGATACGTTGAAGTATTCAAGTCTAACAGTGTTGAAATGG
ATTGGGTGTTGAAGCATACAGGTCCGAATAGCCCTGATACTGCCAACGATGGCTTCGTCCGGCTTAGAGG
ACTCCCATTTGGCTGTAGCAAGGAAGAGATTGTTCAGTTCTTTTCAGGGTTGGAAATTGTGCCAAATGGG
ATGACACTGCCAGTGGACTTTCAGGGGCGAAGCACAGGGGAAGCCTTTGTGCAGTTTGCTTCACAGGAGA
TAGCTGAGAAGGCCTTAAAGAAACACAAGGAAAGAATAGGGCACAGGTACATTGAGATCTTCAAGAGTAG
CCGAGCTGAAGTTCGAACCCACTATGATCCCCCTCGAAAGCTCATGGCTATGCAGCGGCCAGGTCCCTAT
GATAGGCCGGGGGCTGGCAGAGGGTATAATAGCATTGGCAGAGGAGCTGGGTTTGAAAGGATGAGGCGTG
GTGCCTATGGTGGAGGGTATGGAGGCTATGATGACTATGGTGGCTATAATGATGGATATGGCTTTGGGTC
TGATAGATTTGGAAGAGACCTCAATTACTGTTTTTCAGGAATGTCTGATCATAGATACGGAGATGGTGGG
TCCAGTTTCCAGAGCACCACAGGGCACTGTGTACACATGAGGGGGTTACCTTACAGAGCCACTGAGAATG
ATATTTATAATTTCTTCTCACCTCTTAATCCCATGAGAGTACATATTGAAATTGGACCCGATGGCAGAGT
TACCGGTGAGGCAGATGTTGAATTTGCTACTCATGAAGATGCTGTGGCAGCTATGGCAAAAGACAAAGCT
AATATGCAACACAGATATGTGGAGCTCTTCTTAAATTCTACTGCAGGAACAAGTGGGGGTGCTTACGATC
ACAGCTATGTAGAACTTTTTTTGAATTCTACAGCAGGGGCAAGTGGTGGCGCTTATGGTAGCCAAATGAT
GGGAGGGATGGGCTTATCCAACCAGTCTAGTTATGGAGGTCCTGCTAGCCAGCAGCTGAGTGGTGGTTAT
GGAGGTGGTTATGGTGGTCAGAGCAGTATGAGTGGATATGACCAAGTTCTGCAGGAAAACTCCAGTGACT
ATCAGTCAAACCTTGCT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC221204 representing NM_019597
Red=Cloning site Green=Tags(s)

MMLSTEGREGFVVKVRGLPWSCSADEVMRFFSDCKIQNGTSGIRFIYTREGRPSGEAFVELESEEEVKLA
LKKDRETMGHRYVEVFKSNSVEMDWVLKHTGPNSPDTANDGFVRLRGLPFGCSKEEIVQFFSGLEIVPNG
MTLPVDFQGRSTGEAFVQFASQEIAEKALKKHKERIGHRYIEIFKSSRAEVRTHYDPPRKLMAMQRPGPY
DRPGAGRGYNSIGRGAGFERMRRGAYGGGYGGYDDYGGYNDGYGFGSDRFGRDLNYCFSGMSDHRYGDGG
SSFQSTTGHCVHMRGLPYRATENDIYNFFSPLNPMRVHIEIGPDGRVTGEADVEFATHEDAVAAMAKDKA
NMQHRYVELFLNSTAGTSGGAYDHSYVELFLNSTAGASGGAYGSQMMGGMGLSNQSSYGGPASQQLSGGY
GGGYGGQSSMSGYDQVLQENSSDYQSNLA

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_019597
ORF Size 1347 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_019597.1, NM_019597.2, NM_019597.3, NM_019597.4, NP_062543
RefSeq Size 2327
RefSeq ORF 1350
Locus ID 3188
Cytogenetics Xq22.1
Domains rrm
MW 49.1 kDa
Gene Summary This protein is a component of the heterogeneous nuclear ribonucleoprotein (hnRNP) complexes which provide the substrate for the processing events that pre-mRNAs undergo before becoming functional, translatable mRNAs in the cytoplasm. Binds poly(RG). [UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations