SPANXB1 (NM_032461) Human Recombinant Protein

CAT#: TP321009L

Purified recombinant protein of Homo sapiens SPANX family, member B1 (SPANXB1), 1 mg

Product Images

Coomassie blue staining of purified SPANXB1 protein (Cat# TP321009). The protein was produced from HEK293T cells transfected with SPANXB1 cDNA clone (Cat# RC221009) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC221009 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGQQSSVRRLKRSVPCESNEANEANEANKTMPETPTGDSDPQPAPKKMKTSESSTILVVRYRRNVKRTSP
  EELVNDHARENRINPDQMEEEEFIEITTERPKK
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 11.6 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_115850
• Locus ID: 728695
• UniProt ID: Q9NS25
• Cytogenetics: Xq27.1
• Refseq Size: 469
• Refseq ORF: 309
• Synonyms: B1; CT11.2; SPANX-B; SPANXB; SPANXB2; SPANXF1; SPANXF2
• Summary: Temporally regulated transcription and translation of several testis-specific genes is required to initiate the series of molecular and morphological changes in the male germ cell lineage necessary for the formation of mature spermatozoa. This gene is a member of the SPANX family of cancer/testis-associated genes, which are located in a cluster on chromosome X. The SPANX genes encode differentially expressed testis-specific proteins that localize to various subcellular compartments. This particular family member contains an additional 18 nucleotides in its coding region compared to the other family members in the same gene cluster. This family member is also subject to gene copy number variation. Although the protein encoded by this gene contains consensus nuclear localization signals, the major site for subcellular localization of expressed protein is in the cytoplasmic droplets of ejaculated spermatozoa. This protein provides a biochemical marker for studying the unique structures in spermatazoa, while attempting to further define its role in spermatogenesis. [provided by RefSeq, Apr 2014]