CDC42SE1 (NM_020239) Human Recombinant Protein

CAT#: TP319709M

Recombinant protein of human CDC42 small effector 1 (CDC42SE1), transcript variant 2, 100 µg

Product Images

Coomassie blue staining of purified CDC42SE1 protein (Cat# TP319709). The protein was produced from HEK293T cells transfected with CDC42SE1 cDNA clone (Cat# RC219709) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC219709 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSEFWHKLGCCVVEKPQPKKKRRRIDRTMIGEPMNFVHLTHIGSGEMGAGDGLAMTGAVQEQMRSKGNRD
  RPWSNSRGL
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 8.7 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_064624
• Locus ID: 56882
• UniProt ID: Q9NRR8
• Cytogenetics: 1q21.3
• Refseq Size: 3057
• Refseq ORF: 237
• Synonyms: SCIP1; SPEC1
• Summary: Probably involved in the organization of the actin cytoskeleton by acting downstream of CDC42, inducing actin filament assembly. Alters CDC42-induced cell shape changes. In activated T-cells, may play a role in CDC42-mediated F-actin accumulation at the immunological synapse. May play a role in early contractile events in phagocytosis in macrophages.[UniProtKB/Swiss-Prot Function]