MTUS2 (NM_015233) Human Recombinant Protein
CAT#: TP319139
Recombinant protein of human KIAA0774 (KIAA0774), transcript variant 2, 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC219139 representing NM_015233
Red=Cloning site Green=Tags(s) MGHCCCKPYNCLQCLDKTNESALVKEKELSIELANIRDEVAFHTAKCEKLQKEKEELERRFEDEVKRLGW QQQAELQELEERLQLQFEAEMARLQEEHGDQLLSIRCQHQEQVEDLTASHDAALLEMENNHTVAITILQD DHDHKVQELMSTHELEKKELEENFEKLRLSLQDQVDTLTFQSQSLRDRARRFEEALRKNTEEQLEIALAP YQHLEEDMKSLKQVLEMKNQQIHEQEKKILELEKLAEKNIILEEKIQVLQQQNEDLKARIDQNTVVTRQL SEENANLQEYVEKETQEKKRLSRTNEELLWKLQTGDPTSPIKLSPTSPVYRGSSSGPSSPARVSTTPR myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 40.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_056048 |
Locus ID | 23281 |
UniProt ID | Q5JR59, Q5JR59-3 |
Cytogenetics | 13q12.3 |
Refseq Size | 1779 |
Refseq ORF | 1044 |
Synonyms | CAZIP; ICIS; KIAA0774; TIP150 |
Summary | Binds microtubules. Together with MAPRE1 may target the microtubule depolymerase KIF2C to the plus-end of microtubules. May regulate the dynamics of microtubules at their growing distal tip.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC414704 | MTUS2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC422408 | MTUS2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 206.00 |
|
LY414704 | Transient overexpression lysate of microtubule associated tumor suppressor candidate 2 (MTUS2), transcript variant 2 |
USD 436.00 |
|
LY422408 | Transient overexpression lysate of microtubule associated tumor suppressor candidate 2 (MTUS2), transcript variant 1 |
USD 665.00 |
|
PH319139 | MTUS2 MS Standard C13 and N15-labeled recombinant protein (NP_056048) |
USD 3,255.00 |
{0} Product Review(s)
Be the first one to submit a review