GIPC (GIPC1) (NM_005716) Human Recombinant Protein
CAT#: TP316466
Recombinant protein of human GIPC PDZ domain containing family, member 1 (GIPC1), transcript variant 1, 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC216466 representing NM_005716
Red=Cloning site Green=Tags(s) MPLGLGRRKKAPPLVENEEAEPGRGGLGVGEPGPLGGGGSGGPQMGLPPPPPALRPRLVFHTQLAHGSPT GRIEGFTNVKELYGKIAEAFRLPTAEVMFCTLNTHKVDMDKLLGGQIGLEDFIFAHVKGQRKEVEVFKSE DALGLTITDNGAGYAFIKRIKEGSVIDHIHLISVGDMIEAINGQSLLGCRHYEVARLLKELPRGRTFTLK LTEPRKAFDMISQRSAGGRPGSGPQLGTGRGTLRLRSRGPATVEDLPSAFEEKAIEKVDDLLESYMGIRD TELAATMVELGKDKRNPDELAEALDERLGDFAFPDEFVFDVWGAIGDAKVGRY myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 35.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_005707 |
Locus ID | 10755 |
UniProt ID | O14908, A0A024R7I0 |
Cytogenetics | 19p13.12 |
Refseq Size | 1947 |
Refseq ORF | 999 |
Synonyms | C19orf3; GIPC; GLUT1CBP; Hs.6454; IIP-1; NIP; OPDM2; RGS19IP1; SEMCAP; SYNECTIIN; SYNECTIN; TIP-2 |
Summary | GIPC1 is a scaffolding protein that regulates cell surface receptor expression and trafficking (Lee et al., 2008 [PubMed 18775991]).[supplied by OMIM, Apr 2009] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC404361 | GIPC1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC404363 | GIPC1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC417114 | GIPC1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY404361 | Transient overexpression lysate of GIPC PDZ domain containing family, member 1 (GIPC1), transcript variant 3 |
USD 436.00 |
|
LY404363 | Transient overexpression lysate of GIPC PDZ domain containing family, member 1 (GIPC1), transcript variant 5 |
USD 436.00 |
|
LY417114 | Transient overexpression lysate of GIPC PDZ domain containing family, member 1 (GIPC1), transcript variant 1 |
USD 436.00 |
|
PH301175 | GIPC1 MS Standard C13 and N15-labeled recombinant protein (NP_974199) |
USD 3,255.00 |
|
PH316466 | GIPC1 MS Standard C13 and N15-labeled recombinant protein (NP_005707) |
USD 3,255.00 |
|
PH324373 | GIPC1 MS Standard C13 and N15-labeled recombinant protein (NP_974197) |
USD 3,255.00 |
|
TP301175 | Recombinant protein of human GIPC PDZ domain containing family, member 1 (GIPC1), transcript variant 5, 20 µg |
USD 867.00 |
|
TP324373 | Recombinant protein of human GIPC PDZ domain containing family, member 1 (GIPC1), transcript variant 3, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review