ATP8B2 (NM_001005855) Human Recombinant Protein
CAT#: TP315926
Recombinant protein of human ATPase, class I, type 8B, member 2 (ATP8B2), transcript variant 2, 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC215926 representing NM_001005855
Red=Cloning site Green=Tags(s) MAVCAKKRPPEEERRARANDREYNEKFQYASNCIKTSKYNILTFLPVNLFEQFQEVANTYFLFLLILQLI PQISSLSWFTTIVPLVLVLTITAVKDATDDYFRHKSDNQVNNRQSQVLINGILQQEQWMNVCVGDIIKLE NNQFVAADLLLLSSSEPHGLCYIETAELDGETNMKVRQAIPVTSELGDISKLAKFDGEVICEPPNNKLDK FSGTLYWKENKFPLSNQNMLLRGCVLRNTEWCFGLVIFAGPDTKLMQNSGRTKFKRTSIDRLMNTLVLWI FGFLVCMGVILAIGNAIWEHEVGMRFQVYLPWDEAVDSAFFSGFLSFWSYIIILNTVVPISLYVRYVPSL TWGLSRESGGPIELFFSMKMKSLRSNEKSSSSCTVNI myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 44 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001005855 |
Locus ID | 57198 |
UniProt ID | P98198 |
Cytogenetics | 1q21.3 |
Refseq Size | 1560 |
Refseq ORF | 1161 |
Synonyms | ATPID |
Summary | The protein encoded by this gene belongs to the family of P-type cation transport ATPases, and to the subfamily of aminophospholipid-transporting ATPases. The aminophospholipid translocases transport phosphatidylserine and phosphatidylethanolamine from one side of a bilayer to another. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC423664 | ATP8B2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY423664 | Transient overexpression lysate of ATPase, class I, type 8B, member 2 (ATP8B2), transcript variant 2 |
USD 436.00 |
|
PH315926 | ATP8B2 MS Standard C13 and N15-labeled recombinant protein (NP_001005855) |
USD 3,255.00 |
{0} Product Review(s)
Be the first one to submit a review