SNTN (NM_001080537) Human Recombinant Protein

CAT#: TP314753

Recombinant protein of human sentan, cilia apical structure protein (SNTN), 20 µg

Product Images

Coomassie blue staining of purified SNTN protein (Cat# TP314753). The protein was produced from HEK293T cells transfected with SNTN cDNA clone (Cat# RC214753) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC214753 representing NM_001080537
  Red=Cloning site Green=Tags(s)
  
  MGGCMHSTQDKSLHLEGDPNPSAAPTSTCAPRKMPKRISISKQLASVKALRKCSDLEKAIATTALIFRNS
  SDSDGKLEKAIAKDLLQTQFRNFAEGQETKPKYREILSELDEHTENKLDFEDFMILLLSITVMSDLLQNI
  RNVKIMK
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 16.3 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001074006
• Locus ID: 132203
• UniProt ID: A6NMZ2
• Cytogenetics: 3p14.2
• Refseq Size: 1586
• Refseq ORF: 441
• Synonyms: S100A1L; S100AL; sentan
• Summary: May be a component of the linker structure that bridges the ciliary membrane and peripheral singlet microtubules.[UniProtKB/Swiss-Prot Function]