Cell adhesion molecule 4 (CADM4) (NM_145296) Human Recombinant Protein

CAT#: TP313683

Recombinant protein of human cell adhesion molecule 4 (CADM4), 20 µg

Product Images

Coomassie blue staining of purified CADM4 protein (Cat# TP313683). The protein was produced from HEK293T cells transfected with CADM4 cDNA clone (Cat# RC213683) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC213683 representing NM_145296
  Red=Cloning site Green=Tags(s)
  
  MGRARRFQWPLLLLWAAAAGPGAGQEVQTENVTVAEGGVAEITCRLHQYDGSIVVIQNPARQTLFFNGTR
  ALKDERFQLEEFSPRRVRIRLSDARLEDEGGYFCQLYTEDTHHQIATLTVLVAPENPVVEVREQAVEGGE
  VELSCLVPRSRPAATLRWYRDRKELKGVSSSQENGKVWSVASTVRFRVDRKDDGGIIICEAQNQALPSGH
  SKQTQYVLDVQYSPTARIHASQAVVREGDTLVLTCAVTGNPRPNQIRWNRGNESLPERAEAVGETLTLPG
  LVSADNGTYTCEASNKHGHARALYVLVVYDPGAVVEAQTSVPYAIVGGILALLVFLIICVLVGMVWCSVR
  QKGSYLTHEASGLDEQGEAREAFLNGSDGHKRKEEFFI
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 42.6 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_660339
• Locus ID: 199731
• UniProt ID: Q8NFZ8
• Cytogenetics: 19q13.31
• Refseq Size: 2176
• Refseq ORF: 1164
• Synonyms: IGSF4C; Necl-4; NECL4; synCAM4; TSLL2
• Summary: Involved in the cell-cell adhesion. Has calcium- and magnesium-independent cell-cell adhesion activity. May have tumor-suppressor activity.[UniProtKB/Swiss-Prot Function]
• Protein Families: Transmembrane