KCNAB3 (NM_004732) Human Recombinant Protein

CAT#: TP313514L

Recombinant protein of human potassium voltage-gated channel, shaker-related subfamily, beta member 3 (KCNAB3), 1 mg

Product Images

Coomassie blue staining of purified KCNAB3 protein (Cat# TP313514). The protein was produced from HEK293T cells transfected with KCNAB3 cDNA clone (Cat# RC213514) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC213514 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MQVSIACTEQNLRSRSSEDRLCGPRPGPGGGNGGPAGGGHGNPPGGGGSGPKARAALVPRPPAPAGALRE
  STGRGTGMKYRNLGKSGLRVSCLGLGTWVTFGSQISDETAEDVLTVAYEHGVNLFDTAEVYAAGKAERTL
  GNILKSKGWRRSSYVITTKIFWGGQAETERGLSRKHIIEGLRGSLERLQLGYVDIVFANRSDPNCPMEEI
  VRAMTYVINQGLALYWGTSRWGAAEIMEAYSMARQFNLIPPVCEQAEHHLFQREKVEMQLPELYHKIGVG
  SVTWYPLACGLITSKYDGRVPDTCRASIKGYQWLKDKVQSEDGKKQQAKVMDLLPVAHQLGCTVAQLAIA
  WCLRSEGVSSVLLGVSSAEQLIEHLGALQVLSQLTPQTVMEIDGLLGNKPHSKK
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 43.5 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_004723
• Locus ID: 9196
• UniProt ID: O43448
• Cytogenetics: 17p13.1
• Refseq Size: 2458
• Refseq ORF: 1212
• Synonyms: AKR6A9; KCNA3.1B; KCNA3B; KV-BETA-3
• Summary: This gene encodes a member of the potassium channel, voltage-gated, shaker-related subfamily. The encoded protein is one of the beta subunits, which are auxiliary proteins associating with functional Kv-alpha subunits. The encoded protein forms a heterodimer with the potassium voltage-gated channel, shaker-related subfamily, member 5 gene product and regulates the activity of the alpha subunit. [provided by RefSeq, May 2012]
• Protein Families: Druggable Genome, Ion Channels: Other