LST1 (NM_205839) Human Recombinant Protein

CAT#: TP313326

Recombinant protein of human leukocyte specific transcript 1 (LST1), transcript variant 4, 20 µg

Product Images

Coomassie blue staining of purified LST1 protein (Cat# TP313326). The protein was produced from HEK293T cells transfected with LST1 cDNA clone (Cat# RC213326) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC213326 representing NM_205839
  Red=Cloning site Green=Tags(s)
  
  MLSRNDDICIYGGLGLGGLLLLAVVLLSACLCWLHRRVKRLERSWAQGSSEQELHYASLQRLPVPSSEGP
  DLRGRDKRGTKEDPRADYACIAENKPT
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 10.6 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_995311
• Locus ID: 7940
• UniProt ID: O00453, A0A024RCT6, Q5SP24
• Cytogenetics: 6p21.33
• Refseq Size: 769
• Refseq ORF: 291
• Synonyms: B144; D6S49E; LST-1
• Summary: The protein encoded by this gene is a membrane protein that can inhibit the proliferation of lymphocytes. Expression of this gene is enhanced by lipopolysaccharide, interferon-gamma, and bacteria. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2011]
• Protein Families: Transmembrane