LST1 (NM_205839) Human Mass Spec Standard

CAT#: PH313326

LST1 MS Standard C13 and N15-labeled recombinant protein (NP_995311)

Product Images

Coomassie blue staining of purified LST1 protein (Cat# TP313326). The protein was produced from HEK293T cells transfected with LST1 cDNA clone (Cat# RC213326) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC213326
• Predicted MW: 10.8 kDa
• Protein Sequence:
  Sequence Link

  >RC213326 representing NM_205839
  Red=Cloning site Green=Tags(s)
  
  MLSRNDDICIYGGLGLGGLLLLAVVLLSACLCWLHRRVKRLERSWAQGSSEQELHYASLQRLPVPSSEGP
  DLRGRDKRGTKEDPRADYACIAENKPT
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_995311
• RefSeq Size: 769
• RefSeq ORF: 291
• Synonyms: B144; D6S49E; LST-1
• Locus ID: 7940
• UniProt ID: O00453, A0A024RCT6, Q5SP24
• Cytogenetics: 6p21.33
• Summary: The protein encoded by this gene is a membrane protein that can inhibit the proliferation of lymphocytes. Expression of this gene is enhanced by lipopolysaccharide, interferon-gamma, and bacteria. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2011]
• Protein Families: Transmembrane