CEACAM20 (NM_001102597) Human Recombinant Protein

CAT#: TP313248M

Recombinant protein of human carcinoembryonic antigen-related cell adhesion molecule 20 (CEACAM20), transcript variant 5L, 100 µg

Size: 20 ug 100 ug 1 mg


USD 2,950.00

6 Weeks*

Size
    • 100 ug

Product Images

Frequently bought together (2)
CEACAM20 Antibody - C-terminal region
    • 100 ul

USD 539.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

USD 471.00

Other products for "CEACAM20"

Specifications

Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>RC213248 representing NM_001102597
Red=Cloning site Green=Tags(s)

MGPADSWGHHWMGILLSASLCTVWSPPAAAQLTLNANPLDATQSEDVVLPVFGTPRTPQIHGRSRELAKP
SIAVSPGTAIEQKDMVTFYCTTKDVNITIHWVSNNLSVVFHERMQLSKDGKILTILIVQREDSGTYQCEA
RDALLSQRSDPIFLDVKYGPDPVEIKLESGVASGEVVEVMEGSSMTFLAETKSHPPCAYTWFLLDSILSH
TTRTFTIHAVSREHEGLYRCLVSNSATHLSSLGTLKVRVLETLTMPQVVPSSLNLVENARSVDLTCQTVN
QSVNVQWFLSGQPLLPSEHLQLSADNRTLIIHGLQRNDTGPYACEVWNWGSRARSEPLELTINYGPDQVH
ITRESASEMISTIEAELNSSLTLQCWAESKPGAEYRWTLEHSTGEHLGEQLIIRALTWEHDGIYNCTASN
SLTGLARSTSVLVKVVGPQSSSLSSGAIAGIVIGILAVIAVASELGYFLYIRNARRPSRKTTEDPSHETS
QPIPKEEHPTEPSSESLSPEYCNISQLQGRIRVELMQPPDLPEETYETKLPSASRRGNSFSPWKPPPKPL
MPPLRLVSTVPKNMESIYEELVNPEPNTYIQINPSV

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 65.6 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_001096067
Locus ID 125931
UniProt ID Q6UY09
Cytogenetics 19q13.31
Refseq Size 1809
Refseq ORF 1788
Synonyms UNQ9366
Summary Together with the tyrosine-protein kinase SYK, enhances production of the cytokine CXCL8/IL-8 via the NFKB pathway and may thus have a role in the intestinal immune response.[UniProtKB/Swiss-Prot Function]
Protein Families Transmembrane

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.