HSD17B13 (NM_178135) Human Recombinant Protein

CAT#: TP313132-B

Purified Biotinylated recombinant human hydroxysteroid (17-beta) dehydrogenase 13 (HSD17B13) with C-terminal DDK tag and site-specific Biotinylation on the C-terminal AVIplus tag, 20 µg

Product Images

Purified recombinant protein HSD17B13 was analyzed by SDS-PAGE gel and Coomossie Blue Staining.

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC213132 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MNIILEILLLLITIIYSYLESLVKFFIPQRRKSVAGEIVLITGAGHGIGRQTTYEFAKRQSILVLWDINK
  RGVEETAAECRKLGVTAHAYVVDCSNREEIYRSLNQVKKEVGDVTIVVNNAGTVYPADLLSTKDEEITKT
  FEVNILGHFWITKALLPSMMERNHGHIVTVASVCGHEGIPYLIPYCSSKFAAVGFHRGLTSELQALGKTG
  IKTSCLCPVFVNTGFTKNPSTRLWPVLETDEVVRSLIDGILTNKKMIFVPSYINIFLRLQKFLPERASAI
  LNRMQNIQFEAVVGHKIKMK
  
  myc-FLAG tag
• Tag: C-DDK
• Predicted MW: 36.8KDa
• Concentration: >0.05 µg/µL as determined by Bradford protein assay method.
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Bioactivity: The biotin to protein ratio is about 0.2 as determined by Streptavidin Pull-Down Assay.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_835236
• Locus ID: 345275
• UniProt ID: Q7Z5P4
• Cytogenetics: 4q22.1
• Refseq Size: 2397
• Refseq ORF: 900
• Synonyms: HMFN0376; NIIL497; SCDR9; SDR16C3
• Protein Families: Druggable Genome, Secreted Protein, Transmembrane