AZI2 (NM_022461) Human Recombinant Protein

CAT#: TP311435

Recombinant protein of human 5-azacytidine induced 2 (AZI2), transcript variant 1, 20 µg

Product Images

Coomassie blue staining of purified AZI2 protein (Cat# TP311435). The protein was produced from HEK293T cells transfected with AZI2 cDNA clone (Cat# RC211435) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC211435 representing NM_022461
  Red=Cloning site Green=Tags(s)
  
  MDALVEDDICILNHEKAHKRDTVTPVSIYSGDESVASHFALVTAYEDIKKRLKDSEKENSLLKKRIRFLE
  EKLIARFEEETSSVGREQVNKAYHAYREVCIDRDNLKSKLDKMNKDNSESLKVLNEQLQSKEVELLQLRT
  EVETQQVMRNLNPPSSNWEVEKLSCDLKIHGLEQELELMRKECSDLKIELQKAKQTDPYQEDNLKSRDLQ
  KLSISSDNMQHAYWELKREMSNLHLVTQVQAELLRKLKTSTAIKKACAPVGCSEDLGRDSTKLHLMNFTA
  TYTRHPPLLPNGKALCHTTSSPLPGDVKVLSEKAILQSWTDNERSIPNDGTCFQEHSSYGRNSLEDNSWV
  FPSPPKSSETAFGETKTKTLPLPNLPPLHYLDQHNQNCLYKN
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 44.8 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_071906
• Locus ID: 64343
• UniProt ID: Q9H6S1, C9JB40
• Cytogenetics: 3p24.1
• Refseq Size: 3113
• Refseq ORF: 1176
• Synonyms: AZ2; NAP1; TILP
• Summary: AZI2, or NAP1, contributes to the activation of NFKB (see MIM 164011)-dependent gene expression by activating IKK-related kinases, such as NAK (TBK1; MIM 604834) (Fujita et al., 2003 [PubMed 14560022]).[supplied by OMIM, Mar 2008]
• Protein Pathways: RIG-I-like receptor signaling pathway