AZI2 (NM_022461) Human Mass Spec Standard

CAT#: PH311435

AZI2 MS Standard C13 and N15-labeled recombinant protein (NP_071906)

Product Images

Coomassie blue staining of purified AZI2 protein (Cat# TP311435). The protein was produced from HEK293T cells transfected with AZI2 cDNA clone (Cat# RC211435) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC211435
• Predicted MW: 44.8 kDa
• Protein Sequence:
  Sequence Link

  >RC211435 representing NM_022461
  Red=Cloning site Green=Tags(s)
  
  MDALVEDDICILNHEKAHKRDTVTPVSIYSGDESVASHFALVTAYEDIKKRLKDSEKENSLLKKRIRFLE
  EKLIARFEEETSSVGREQVNKAYHAYREVCIDRDNLKSKLDKMNKDNSESLKVLNEQLQSKEVELLQLRT
  EVETQQVMRNLNPPSSNWEVEKLSCDLKIHGLEQELELMRKECSDLKIELQKAKQTDPYQEDNLKSRDLQ
  KLSISSDNMQHAYWELKREMSNLHLVTQVQAELLRKLKTSTAIKKACAPVGCSEDLGRDSTKLHLMNFTA
  TYTRHPPLLPNGKALCHTTSSPLPGDVKVLSEKAILQSWTDNERSIPNDGTCFQEHSSYGRNSLEDNSWV
  FPSPPKSSETAFGETKTKTLPLPNLPPLHYLDQHNQNCLYKN
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_071906
• RefSeq Size: 3113
• RefSeq ORF: 1176
• Synonyms: AZ2; NAP1; TILP
• Locus ID: 64343
• UniProt ID: Q9H6S1, C9JB40
• Cytogenetics: 3p24.1
• Summary: AZI2, or NAP1, contributes to the activation of NFKB (see MIM 164011)-dependent gene expression by activating IKK-related kinases, such as NAK (TBK1; MIM 604834) (Fujita et al., 2003 [PubMed 14560022]).[supplied by OMIM, Mar 2008]
• Protein Pathways: RIG-I-like receptor signaling pathway