ASC2 (PYDC1) (NM_152901) Human Recombinant Protein

CAT#: TP311240

Recombinant protein of human PYD (pyrin domain) containing 1 (PYDC1), 20 µg

Product Images

Coomassie blue staining of purified PYDC1 protein (Cat# TP311240). The protein was produced from HEK293T cells transfected with PYDC1 cDNA clone (Cat# RC211240) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC211240 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGTKREAILKVLENLTPEELKKFKMKLGTVPLREGFERIPRGALGQLDIVDLTDKLVASYYEDYAAELVV
  AVLRDMRMLEEAARLQRAA
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 9.9 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_690865
• Locus ID: 260434
• UniProt ID: Q8WXC3
• Cytogenetics: 16p11.2
• Refseq Size: 582
• Refseq ORF: 267
• Synonyms: ASC2; cPOP1; POP1; PYC1
• Summary: Associates with PYCARD/ASC and modulates its ability to collaborate with MEFV/pyrin and NLRP3/cryopyrin in NF-kappa-B and pro-caspase-1 activation. Suppresses kinase activity of NF-kappa-B inhibitor kinase (IKK) complex, expression of NF-kappa-B inducible genes and inhibits NF-kappa-B activation by cytokines and LPS.[UniProtKB/Swiss-Prot Function]
• Protein Pathways: NOD-like receptor signaling pathway