ASC2 (PYDC1) (NM_152901) Human Recombinant Protein
CAT#: TP311240M
Recombinant protein of human PYD (pyrin domain) containing 1 (PYDC1), 100 µg
Frequently bought together (2)
Other products for "ASC2"
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC211240 protein sequence
Red=Cloning site Green=Tags(s) MGTKREAILKVLENLTPEELKKFKMKLGTVPLREGFERIPRGALGQLDIVDLTDKLVASYYEDYAAELVV AVLRDMRMLEEAARLQRAA myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 9.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_690865 |
Locus ID | 260434 |
UniProt ID | Q8WXC3 |
Cytogenetics | 16p11.2 |
Refseq Size | 582 |
Refseq ORF | 267 |
Synonyms | ASC2; cPOP1; POP1; PYC1 |
Summary | Associates with PYCARD/ASC and modulates its ability to collaborate with MEFV/pyrin and NLRP3/cryopyrin in NF-kappa-B and pro-caspase-1 activation. Suppresses kinase activity of NF-kappa-B inhibitor kinase (IKK) complex, expression of NF-kappa-B inducible genes and inhibits NF-kappa-B activation by cytokines and LPS.[UniProtKB/Swiss-Prot Function] |
Protein Pathways | NOD-like receptor signaling pathway |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.